To:
`
`Subject:
`
`Sent:
`
`Sent As:
`
`Attachments:
`
`Fox Media LLC (foxtrademarks@fox.com)
`
`U.S. Trademark Application Serial No. 88631059 - FOX SPORTS SUPER 6 - 81409013
`
`December 15, 2019 12:28:30 PM
`
`ecom122@uspto.gov
`
`Attachment - 1
`Attachment - 2
`Attachment - 3
`Attachment - 4
`Attachment - 5
`Attachment - 6
`Attachment - 7
`Attachment - 8
`Attachment - 9
`Attachment - 10
`Attachment - 11
`Attachment - 12
`Attachment - 13
`Attachment - 14
`Attachment - 15
`
`United States Patent and Trademark Office (USPTO)
`Office Action (Official Letter) About Applicant’s Trademark Application
`
`U.S. Application
`Serial No. 88631059
`
`Mark:   FOX SPORTS
`SUPER 6
`
`Correspondence
`Address: 
`NEIL VOHRA
`FOX MEDIA LLC
`10201 WEST PICO
`BOULEVARD
`LOS ANGELES, CA
`90035
`
`     
`    
`   
`
`Applicant:   Fox Media
`LLC
`
`    
`
`Reference/Docket No.
`81409013
`
`Correspondence
`
`Email Address:  
`
`foxtrademarks@fox.com
`
`NONFINAL OFFICE ACTION
`
`The USPTO must receive applicant’s response to this letter within six months of the issue date below or the application will be abandoned. 
`Respond using the Trademark Electronic Application System (TEAS).   A link to the appropriate TEAS response form appears at the end of this
`Office action. 
`
` 
` 
` 
` 
` 
`

`

`Issue date:  December 15, 2019
`
`The referenced application has been reviewed by the assigned trademark examining attorney.  Applicant must respond timely and completely to
`the issues below.  15 U.S.C. §1062(b); 37 C.F.R. §§2.62(a), 2.65(a); TMEP §§711, 718.03.
`
`SUMMARY OF ISSUES:
`Prior-Filed Application Advisory
`Amendment of Identification of Goods and/or Services Required
`Multi-Class Advisory
`Disclaimer Required
`
`PRIOR-FILED APPLICATION ADVISORY
`
`The trademark examining attorney has searched the USPTO’s database of registered and pending marks and has found no similar registered
`marks that would bar registration under Trademark Act Section 2(d).  TMEP §704.02; see 15 U.S.C. §1052(d).  However, a mark in a prior-filed
`pending application may present a bar to registration of applicant’s mark.
`
`The filing dates of pending U.S. Application Serial Nos. 88142862 and 88142868 precede applicant’s filing date.  See attached referenced
`applications.  If a mark in the referenced applications registers, applicant’s mark may be refused registration under Trademark Act Section 2(d)
`because of a likelihood of confusion between the two marks.  See 15 U.S.C. §1052(d); 37 C.F.R. §2.83; TMEP §§1208 et seq.  Therefore, upon
`receipt of applicant’s response to this Office action, action on this application may be suspended pending final disposition of the earlier-filed
`referenced application(s).
`
`In response to this Office action, applicant may present arguments in support of registration by addressing the issue of the potential conflict
`between applicant’s mark and the mark in the referenced applications.  Applicant’s election not to submit arguments at this time in no way
`limits applicant’s right to address this issue later if a refusal under Section 2(d) issues.
`
`AMENDMENT OF IDENTIFICATION OF GOODS AND/OR SERVICES REQUIRED
`
`The wording “Computer software” in the identification of goods for International Class 9 must be clarified because it is too broad and could
`include goods in other international classes.  See 37 C.F.R. §2.32(a)(6); TMEP §§1402.01, 1402.03.  In particular, this wording could encompass
`“downloadable computer software for tracking sports, sporting events, gaming and gambling” in Class 9; “providing temporary use of non-
`downloadable computer game software” in Class 41; and “providing temporary use of non-downloadable computer software for tracking sports,
`sporting events, gaming and gambling” in Class 42.
`
`The wording “downloadable mobile applications” in the identification of goods is indefinite and must be clarified because the function of the
`mobile applications must be specified.  See 37 C.F.R. §2.32(a)(6); TMEP §1402.01.  Applicant may substitute the following wording, if
`accurate:  “downloadable mobile applications for tracking sports, sporting events, gaming and gambling.”
`
`Applicant may adopt the following identification, if accurate (examining attorney’s suggestions in bold font):
`
`Class 9:          
`
`downloadable computer software for tracking sports, sporting events, gaming and gambling; downloadable mobile
`applications for tracking sports, sporting events, gaming and gambling; downloadable game software; downloadable
`interactive game software; downloadable computer game software; downloadable electronic game software; downloadable video
`game software; recorded game software; downloadable and recorded gaming software for gambling; downloadable games that
`accept virtual or monetary wagers sold as a feature of downloadable game software; downloadable mobile applications for sports,
`sporting events, gaming and gambling; downloadable mobile applications for social networking and collecting, editing,
`organizing, modifying, displaying, tagging, sharing, or otherwise providing media or information; downloadable electronic
`publications in the nature of newsletters and blogs in the fields of entertainment, gaming, gambling, sports, and sporting events;
`virtual reality headsets; virtual reality glasses; downloadable virtual reality software for sports, sporting events, gaming, and
`betting
`
`Class 41:        
`
`providing temporary use of non-downloadable computer game software
`
`Class 42:        
`
`providing temporary use of non-downloadable computer software for tracking sports, sporting events, gaming and
`gambling
`
`  
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
`

`

`See TMEP §§ 1402.01, 1402.03.
`
`Applicant may amend the identification to clarify or limit the goods and/or services, but not to broaden or expand the goods and/or services
`beyond those in the original application or as acceptably amended.  See 37 C.F.R. §2.71(a); TMEP §1402.06.  Generally, any deleted goods
`and/or services may not later be reinserted.  See TMEP §1402.07(e).
`
`For assistance with identifying and classifying goods and services in trademark applications, please see the USPTO’s online searchable U.S.
`Acceptable Identification of Goods and Services Manual.  See TMEP §1402.04.
`
`MULTI-CLASS ADVISORY
`
`The application identifies goods and/or services in more than one international class; therefore, applicant must satisfy all the requirements below
`for each international class based on Trademark Act Section 1(b):
`
`(1)       
`
`(2)       
`
`List the goods and/or services by their international class number in consecutive numerical order, starting with the lowest
`numbered class.
`
`Submit a filing fee for each international class not covered by the fee already paid (view the USPTO’s current fee schedule ).  The
`application identifies goods and/or services that are classified in at least three classes; however, applicant submitted a fee sufficient
`for only one class.  Applicant must either submit the filing fees for the classes not covered by the submitted fees or restrict the
`application to the number of classes covered by the fees already paid.
`
`See 15 U.S.C. §§1051(b), 1112, 1126(e); 37 C.F.R. §§2.32(a)(6)-(7), 2.34(a)(2)-(3), 2.86(a); TMEP §§1403.01, 1403.02(c).
`
`See an overview of the requirements for a Section 1(b) multiple-class application and how to satisfy the requirements online using the Trademark
`Electronic Application System (TEAS) form.
`
`DISCLAIMER REQUIRED
`
`Applicant must provide a disclaimer of the unregistrable part(s) of the applied-for mark even though the mark as a whole appears to be
`registrable.  See 15 U.S.C. §1056(a); TMEP §§1213, 1213.03(a).  A disclaimer of an unregistrable part of a mark will not affect the mark’s
`appearance.  See Schwarzkopf v. John H. Breck, Inc., 340 F.2d 978, 979-80, 144 USPQ 433, 433 (C.C.P.A. 1965).
`
`In this case, applicant must disclaim the wording “SPORTS SUPER 6” because it is not inherently distinctive.   These unregistrable term(s) at
`best are merely descriptive of a characteristic of applicant’s goods and/or services.   See 15 U.S.C. §1052(e)(1); DuoProSS Meditech Corp. v.
`
`Inviro Med. Devices, Ltd., 695 F.3d 1247, 1251, 103 USPQ2d 1753, 1755 (Fed. Cir. 2012); TMEP §§1213, 1213.03(a).  
`
`The attached evidence from ahdictionary.com shows “SPORT” is defined as “an activity involving physical exertion and skill that is governed
`by a set of rules or customs and often undertaken competitively.”
`
`The attached evidence from ahdictionary.com shows “SUPER” is defined as “an article or a product of superior size, quality, or grade.”
`
`“Marks that are merely laudatory and descriptive of the alleged merit of a product [or service] are . . . regarded as being descriptive” because
`“[s]elf-laudatory or puffing marks are regarded as a condensed form of describing the character or quality of the goods [or services].”  
`DuoProSS Meditech Corp. v. Inviro Med. Devices, Ltd., 695 F.3d 1247, 1256, 103 USPQ2d 1753, 1759 (Fed. Cir. 2012) (quoting In re The
`
`Boston Beer Co., 198 F.3d 1370, 1373, 53 USPQ2d 1056, 1058 (Fed. Cir. 1999)); TMEP §1209.03(k).  
`
`The Trademark Trial and Appeal Board has determined that “if the word ‘super’ is combined with a word [that] names the goods or services, or
`a principal component, grade or size thereof, then the composite term is considered merely descriptive of the goods or services.”   In re Phillips-
`Van Heusen Corp., 63 USPQ2d 1047, 1052 (TTAB 2002) (holding SUPER SILK merely laudatory and descriptive of applicant’s shirts being of
`an excellent, first-rate, or superior grade of silk fabric), quoted in In re Positec Grp. Ltd., 108 USPQ2d 1161, 1172 (TTAB 2013) (holding
`SUPERJAWS merely descriptive of applicant’s various machine tools, hand tools, and heavy-duty workbench accessories as superior vice
`systems for grasping and holding work pieces); see In re Carter-Wallace, Inc., 222 USPQ 729, 730 (TTAB 1984) (holding SUPER GEL merely
`laudatory and descriptive of applicant’s shaving gel being of superior quality).
`
`The attached evidence from ahdictionary.com shows “6” or “SIX” is defined as “something having six parts, units, or members.”
`
`Thus, the terms “SPORTS SUPER 6” merely describe characteristics or features of the applicant’s goods/services, namely, superior computer
`
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
` 
`

`

`game software featuring 6 sporting events, as indicated on the applicant’s attached website.
`
`Applicant may respond to this issue by submitting a disclaimer in the following format:  
`No claim is made to the exclusive right to use “SPORTS SUPER 6” apart from the mark as shown.   
`
`For an overview of disclaimers and instructions on how to satisfy this issue using the Trademark Electronic Application System (TEAS), see the
`
`Disclaimer webpage.  
`
`RESPONSE GUIDELINES
`
`Please call or email the assigned trademark examining attorney with questions about this Office action.  Although the trademark examining
`attorney cannot provide legal advice or statements about applicant’s rights, the trademark examining attorney can provide applicant with
`additional explanation about the requirement(s) in this Office action.  See TMEP §§705.02, 709.06.  Although the USPTO does not accept emails
`as responses to Office actions, emails can be used for informal communications and will be included in the application record.  See 37 C.F.R.
`
`§§2.62(c), 2.191; TMEP §§304.01-.02, 709.04-.05.  
`
`TEAS PLUS OR TEAS REDUCED FEE (TEAS RF) APPLICANTS – TO MAINTAIN LOWER FEE, ADDITIONAL
`REQUIREMENTS MUST BE MET, INCLUDING SUBMITTING DOCUMENTS ONLINE:  Applicants who filed their application online
`using the lower-fee TEAS Plus or TEAS RF application form must (1) file certain documents online using TEAS, including responses to Office
`actions (see TMEP §§819.02(b), 820.02(b) for a complete list of these documents); (2) maintain a valid e-mail correspondence address; and (3)
`agree to receive correspondence from the USPTO by e-mail throughout the prosecution of the application.  See 37 C.F.R. §§2.22(b), 2.23(b);
`TMEP §§819, 820.  TEAS Plus or TEAS RF applicants who do not meet these requirements must submit an additional processing fee of $125
`per class of goods and/or services.  37 C.F.R. §§2.6(a)(1)(v), 2.22(c), 2.23(c); TMEP §§819.04, 820.04.  However, in certain situations, TEAS
`Plus or TEAS RF applicants may respond to an Office action by authorizing an examiner’s amendment by telephone or e-mail without incurring
`
`this additional fee.   
`How to respond.   Click to file a response to this nonfinal Office action.        
`
`/Ryan Witkowski/
`Examining Attorney
`Law Office 122
`(571) 272-7584
`ryan.witkowski@uspto.gov
`
`RESPONSE GUIDANCE
`Missing the response deadline to this letter will cause the application to abandon.   A response or notice of appeal must be received by
`the USPTO before midnight Eastern Time of the last day of the response period.   TEAS and ESTTA maintenance or unforeseen
`
`circumstances could affect an applicant’s ability to timely respond.   
`
`Responses signed by an unauthorized party are not accepted and can cause the application to abandon.  If applicant does not have an
`attorney, the response must be signed by the individual applicant, all joint applicants, or someone with legal authority to bind a juristic
`applicant.  If applicant has an attorney, the response must be signed by the attorney.
`
`If needed, find contact information for the supervisor of the office or unit listed in the signature block.
`
` 
` 
`  
` 
` 
`

`

`Pfint:Dec15,2D19
`
`88142362
`
`DESIGN MARK
`
`Serial Number
`88142862
`
`Status
`NOTICE OF ALLOWANCE — ISSUED
`
`Word Mark
`SUPER S
`
`Standard Character Mark
`No
`
`Type Of Mark
`TRADEMARK; SERVICE MARK
`
`Register
`PRINCIPAL
`
`Mark Drawing Code
`[3] DESIGN PLUS WORDS, LETTERS ANDXCR NUMBERS
`
`Owner
`Hewlett Packard Enterprise Development LP LIMITED PARTNERSHIP TEXAS
`11445 Compaq Center Drive West Houston TEXAS 110T0
`
`Goodsmervices
`G & S: Shirts;
`022 039.
`US
`IC 025.
`Class Status -- ACTIVE.
`blouses: t-shirts; jackets: sweaters: baseball caps and hats: sports
`caps and hats; gloves;
`rainwear; windbreakers; sweatshirts; polo
`shirts; ties as clothing; scarves.
`
`GoodSIServices
`
`G & S: Arranging
`100 101 102.
`US
`IC 035.
`Class Status -- ACTIVE.
`and conducting business conferences; retail and online retail store
`services in the field of computers, computer hardware,
`information
`technology [IT] equipment, and computer software.
`
`GoodSIServices
`Class Status —— ACTIVE.
`
`IC 041.
`
`US
`
`100 101 10?.
`
`G & S: Education
`
`
`
`in the nature of classes, seminars, and conferences in the field of
`computers, computer hardware,
`information technology [IT], cloud
`computing, and computer software;
`training in the field of computers,
`computer hardware,
`information technology [IT], cloud computing, and
`computer software; providing a website featuring blogs and
`non—downloadable publications in the nature of articles in the field
`
`of computers, computer hardware,
`information technology [IT], cloud
`computing, and computer software; providing online non—downloadable
`videos in the field of computers, computer hardware,
`information
`technology [IT], cloud computing, and computer software.
`
`.1.
`
`

`

`Pfint:Dec15,2D19
`
`88142362
`
`
`
`GoodslServioes
`G & 8: Consulting in
`100 101.
`US
`IC 042.
`Class Status -- HCTIVE.
`the field of computer technology, computer hardware technology,
`information technology [IT], cloud computing, and computer software;
`design and implementation of computer technologies for others;
`providing virtual computer systems and virtual computer environments
`
`through cloud computing; providing information in the field of
`computer technology. computer hardware technology.
`information
`technology [IT], cloud computing, and computer software.
`
`
`
`
`
`Description of Mark
`The mark consists of the word "SUPER"
`
`in italicized block letters that
`
`are outlined all the way around in light grey and then on the right
`and below in black, that feature vertical gradient black dot pattern
`over a purple background and the number "6" outlined all the way
`around in light grey and then on the right and below in black, that
`features a vertical gradient black dot pattern over a green background
`and a light grey lightning bolt through the center of the number "6".
`
`Colors Claimed
`The colors light grey, purple, black, and green are claimed as a
`feature of the mark
`
`Filing Date
`ZOlBHlOfflé
`
`Examining Attorney
`ROTH, BENJAMIN H
`
`

`

`
`
`

`

`Pfint:Dec15,2D19
`
`88142888
`
`DESIGN MARK
`
`Serial Number
`88142868
`
`Status
`NOTICE OF ALLOWANCE — ISSUED
`
`Word Mark
`SUPER 8
`
`Standard Character Mark
`No
`
`Type Of Mark
`TRADEMARK; SERVICE MARK
`
`Register
`PRINCIPAL
`
`Mark Drawing Code
`[3] DESIGN PLUS WORDS, LETTERS ANDXOR NUMBERS
`
`Owner
`Hewlett Packard Enterprise Development LP LIMITED PARTNERSHIP TEXAS
`11445 Compaq Center Drive West Houston TEXAS 110T0
`
`Goodsmervices
`G & S: Shirts;
`022 039.
`US
`IC 025.
`Class Status -- ACTIVE.
`blouses: t-shirts; jackets: sweaters: baseball caps and hats: sports
`caps and hats; gloves;
`rainwear; windbreakers; sweatshirts; polo
`shirts; ties as clothing; scarves.
`
`GoodSIServices
`
`G & S: Arranging
`100 101 102.
`US
`IC 035.
`Class Status -- ACTIVE.
`and conducting business conferences; retail and online retail store
`services in the field of computers, computer hardware,
`information
`technology [IT] equipment, and computer software.
`
`GoodSIServices
`Class Status —— ACTIVE.
`
`IC 041.
`
`US
`
`100 101 10?.
`
`G & S: Education
`
`
`
`in the nature of classes, seminars, and conferences in the field of
`computers, computer hardware,
`information technology [IT], cloud
`computing, and computer software;
`training in the field of computers,
`computer hardware,
`information technology [IT], cloud computing, and
`computer software; providing a website featuring blogs and
`non—downloadable publications in the nature of articles in the field
`
`of computers, computer hardware,
`information technology [IT], cloud
`computing, and computer software; providing online non—downloadable
`videos in the field of computers, computer hardware,
`information
`technology [IT], cloud computing, and computer software.
`
`.1.
`
`

`

`Pfint:Dec15,2D19
`
`88142888
`
`
`
`GoodslServices
`G & 8: Consulting in
`100 101.
`US
`IC 042.
`Class Status -- HCTIVE.
`the field of computer technology, computer hardware technology,
`information technology [IT], cloud computing, and computer software;
`design and implementation of computer technologies for others;
`providing virtual computer systems and virtual computer environments
`
`through cloud computing; providing information in the field of
`computer technology. computer hardware technology.
`information
`technology [IT], cloud computing, and computer software.
`
`
`
`
`
`Description of Mark
`The mark consists of the word "Super" in black block characters and
`the number "6" in green with a white lightning bolt design through the
`center of the number "6".
`
`Colors Claimed
`The colorls] black, green and white isfare claimed as a feature of the
`mark.
`
`Filing Date
`2018x10j04
`
`Examining Attorney
`ROTH, BENJAMIN H
`
`

`

`
`
`

`

`12/15/2D181D531DAM
`nuns #www enumuunai
`cum/wurd/seamn HIm‘7u:Snun
`
`I” M”
`
`
`
`
`
`
`r.
`
`'
`.
`. 5
`AMERICAN
`HERITAGE'
`
`
`
`
`
` ‘ictldn
`
`English
`Language
`
`SWIM (span)
`n.
`
`
`
`slime meet
`
`mummy maimgphysmaimhmmdskmmamgmmgsbyamof
`101:: wmsmms and oflm \mdmakmtmpdlfivcly
`n. ma: spammsmwizhagng. vmmxnammis magmas agpn‘):
`Spotisisagoodwayinrdfldzmtogflmdi.
`LAmmgmfiwmiMwmspmafm
`meat [ablatwmflhnrithmyfliingfawstflmfuurpapezrupléns‘ 0am
`Kramer).
`tum mhmd unthe unbjustimthespunrfiil.
`1M0ckay,}l:s|:]{emadespmtofinsownboks.
`D.Auohjaclofmodfly,i$l. or play: matedounmeiesisas spun.
`cAjchngmmdmamndc Shemdefllemmarkmspurt.
`lOnekmwnfnrmzmzmaofqne‘smnmnfnfles, especlaflynfagzne,or
`gamma manu- a pomspmt
`b.szmmaEAfzk<ufindrdpssoul especiaflyummomflsmsingmdifficuk
`simafimswnltlkaspmtandshhwmewhemymcaughtflmfish.
`c.1ntomialApimsammp-nmwusamalspmdufingmguip.
`5mm
`a. Apusnniilflm um aguuyflnnuagm lil‘e
`b.AgamMHnspll1ilgemms,
`a. maloymmgmmzmmmwmmamulmmm
`WmMasus-mnfmutaum
`T. Ohsdem Alumnus Mme; lovanzkj'ng,
`v. snort-ed. stamina. snails
`
`"ONTO USETHE
`DiCTlOMRV
` Ia Junk up an envy in me
`Amencan Haulage Drmomryoa‘
`me Ella/m Language use me
`Search winavw abnve Forbes!
`resum‘ anertvung m Ine wum‘
`click an the ‘searcn' Bunon
`instean Dhlslflfl me emer key
`same compnunu words (like bus
`rapid Hausa, cog wmslle Dr
`Mammy mere mom away an
`me urwrnown IbSl wnen you
`blue niem in me seaicn Dar Fur
`best resuils wiln wmnwm}
`words. mace a quotation mam
`heme me camnminu won: in
`me seaicn wlmuw
`m'mmmm'
`
`
`
`
`THEIJSAGE PANEL
` ram Usage Panel is a gimp ui
`nanny 20a pmmmnm scnmars,
`cream wmm,Juumansm
`nmlnmnm :ml nmnmin
`
`
`
` ‘nie anicbes “1 am Hog examine
`new wnms‘ iewsed definillons.
`interesting Images [rem me Mn
`emon‘ mscllsslmls in usage.
`and mare
`
`
`"ERICA“HERITAGE
`DIC'I'DMRYAPP
` me new Amencan Hemage
`nmmnaw app is nwavaname
`iuiice andAndroid
`
`THE 100 WORDS‘
`see worn IHVS from me hm?
`semnq 150 warns was!
`mmmnms'
`
`Fan msrenm
`
`
`
`

`

`Hitps #www ahdmilunai
`
`cum/wurd/saamh himi7u:spun
`
`12/15/2ma m 53 m AM
`
`diphmak‘ am marsh!
`Occupaliolls mquinng masieiy a!
`,
`language Ram-9‘ suwws have
`93:33113‘252‘2293‘2W “'
`33mm 31mm";
`”FWE’
`
`VJ}.
`
`V- sport“. sportinii, spans
`mum:
`1. Tu play in frolic childxmspnrfiug m the mm
`2. Tu1m mm ”Lear
`in 3 am mum, spunedwimyy [he
`awmimirh
`1.Tuwmnrha\‘cmane‘sbody,upmzflyprummm1lymoslmhhmsly:spmts
`diamond ean-ings; spoma mo.
`2. Tahivczsapmminmtfcm:amipotmlganewpaint]ub.
`7
`“‘11-“ 59°“ 7
`NEEDHELPsuva
`1.0cmiznngm,maypuqufmspmis:spmfishmgspomeqmpmm
`Acmsm
`anmgnmmzppmpszmmmmmmmimcaspmm.
`PUZZLE?
`.
`.
`.
`GD \u ulli CWSSWVHI Fume
`[mammm spam 511m in: d15pafle. rmm om Emu: despmt plasma, from
`5mm. and We M m MW
`“ESPOT‘E MM: 556 man]
`malynu know, and me Salve!
`will praumxe a ils’l 0'pusslbie —
`sniunims
`5P"It
`“II M
`sport
`
`fu -ry m. spell mines: in
`
`ThcAmuimHuimgcflDimmzydmcEngjjshngnzgcflflhEdfimnrpydngZDZUby
`nghanifiJinI’hmumanhhshng Campmy,Auxigimmua
`
`"'mu'w'“
`”MARIE“
`Check [mi [712 DICLIUIIB
`Sum
`,
`a“
`a, NW, Am,“ a, W
`mmmmnawswmmm
`
`
`
`India-European & Semitic Roots Appendices
` Thmisamh oi mines mine dim-naryminds eiymnhges mamas: mar L’Illflllfi ham in
`necnnsimded mdoianguags Ynu my: mini" mum Ininllialiin abuul Mess fnmis in am
`Mime Emmm'
`[11¢qu 11mm
`Semilicknots
`The him-wean nuns-m LIWEIS nme M: ui um “imam-num- "mt. mulllave hull inn:-
`mark an English umnis Amine mmnieia imatmant ui Iqido-Eumpsan minis and line English
`words dEliIed rmm them is amiable in our nidinnary ninja-Wm
`This website is hesiviewed in chrome, Fireiox‘ Mimosa“ Edge, M Saiaii Smile mavadels ill vmnunciaiinns and Etymmugies mnnai be displayed ampeiiy in Iniemei Bulimia
`
`Hm mimic: ion-cm \WL'S Ham:
`A“.
`firm Pnhzy [Tm kamdifinnsum,
`H m
`Hawaii"
`MW"
`11.: 17qu Yarn Wntdsnmddmulmi: m mgrafifliflb
`Sunfish 2m Hunauunwmn Hilwnd‘A-‘Inflisvuen‘ad.
`
`

`

`1211mm? m 53 55 AM
`Hitps #www ahmciiunai
`cum/wurd/saamn Hlmi7u:suner
`
`in man up an unity in The
`American Heniage Dicnonaryor
`me Eng/ash Languaye‘ use ine
`seam: winanw amwe Fornest
`[whim alier(Wing iii we want
`cm In ine ‘Searcn' mnw
`instean DIIISIHE me “emer’ key
`same cumpnmifl wmg (me nus
`rapid 123nm. cog wmsfl'fi ur
`memory mam non'i anpear uri
`me umnown Ii51 wnen Yuu
`blue "IE!“ in me seamli liar Fai
`hem resuzis wnn compound
`words. mace awmanon main
`mime me caninwnu wan: in
`
`1.Aniuc§cuzpaulinof§upu1nsim.qinlity.m~gtadc
`2.
`
`
`in: seamn WINIDW mmmm'
`and more
`
`"PM“
`pm.
`1 . Alch; mu; mWW-
`2. Sum“, Ismsiae,qifl1fiy.d:ge:, or nanny: supmud.
`a.
`a. Bounding: mm supmaium.
`.mmumsmammum mm.
`1;. (humming-6pm mgminiinmummny mgipmpom'm
`Wm.
`“um inclimvc an 5min! cm:mpamder.
`[Lillil-l. tam wiper, war. Ibuve; seeupsi indie Appuifix oiWmmnis.1
`mmwmammejmmmmmammw
`mmmmmmmmynmgmm
`su-perwfl ‘(s
`pxuntumi
`n.
`
`Slum: Tons!
`
`11.2 new manna" Humaga
`Diciianaw sun is newavaname
`iuriOS andmid
`
`TI'EAIIZHCAII
`[HUME
`DICI'DMRV BLOG
`The anicies in nu: ulna examine
`new wards iwsed definitions.
`interesting images immme nmi
`amen fllscilsslmls orusage.
`
`Shae W
`
`

`

`
`
`mtps #www ahmcuunav cum/wurd/saamh HIm‘7u:suD2r 12/15QD1BWD 53 55 AM
`
`
`z.
`
`335-
`
`THE 100WORDS’
`See wnm stls mm the Desk
`59"“9 ‘0” WM“ 59mg!
`mm {minute
`
`,
`cum nut me Dmaw swan
`m an Amara a1
`nmmmwnmmnaryscuew-wm
`
`tAslpetmtmdaninanzpmmm’ofiimbndmug
`a. Asum,
`1. Va},large, gm. arm: "yet annfller super9:3,“:an [DylanTlmlas).
`2. Excaflan; 515111153 superPany.
`
`“iv-
`,
`,
`The usage Panel '5 a 9mm nf
`Especially; many: 2 mp2: mmrenusule; was mp2:cueIuL
`mm, 200 ”mum 55mm
`clealwe Wlllevs. Journalists —
`
`[Fmm4
`mamas, and omers in
`_
`_
`_
`_
`_
`_
`_
`_
`_
`mmnaflons lewirmg mastely m
`Hnguage mm surveys nave mmwmmmmflm Emanmmpyngmmozoby
`gauged me ancestanim m
`ngpmmmin Hzmmnl Publishing Gummy, Alldglns mama
`namcular usages and
`mammanca‘ ccnmcfiuns
`mvmmsls’
`
`Indo-European & Sem c Roots Appendices
`SD‘UIIWIS.
`
`
`NEEDIELP 511m
`ACROSSWORD
`?
`Ga 10 ourcrosswnm Puma
`vaerand tyne an the IBM“
`mat W“ “MW, HM me 59M?!
`wm Dream “51 0'9055mm
`
`mmzm a mum Inlhn mmryinmnu mmnuujnc mum mm mg": m m
`mudmi molmguagfi Ynu can uMa'n mum immnalim aha-unless films in Mr
`“'"i'e Emmi"
`semi“:mm:
`[ml-rm knob
`THE Manama" appunfl mm many mi mule Inmampaan mus man-ave lemma
`mall 1m angst. wmls mums Imam» "email at Immenmpaan mm amine Lugs“
`mm: mama mun men! s mam um um mainmry 11!me
`
`nus wensne is heslvlemad m Cmome, Fivelnx Mmesnn E092, m Salali some mavaneus m pnmumanms and etymmug'es cannul be displayed pmpeny il! Imam Explnm:
`
`HmIAbvntU:\ClrEEfl1Wfls\fAQl
`AC.
`Pumaypnfiq ll‘mmhumdfimmnfljx
`Nfllamnn
`mm. m Yquz-eYaw ummmmms ”hymn,
`Hamurl
`Wmmmmmmsm
`
`

`

`
`
`mtps #www ahmmlunav cum/wurd/saamh Mmi7u:sm 12/15/2EI15 m 55 in AM
`
`mm USETHE
`
`?
`
`Iowans: enema/m We
`me Eng/m Language, use me
`American Hemaw Lam-wrya:
`
`six "J- (sits)
`n
`
`1 . The animal mntbu equal in 5 + a
`z. mmmzmmaqm,
`a. Snuzlhm'gim sixpxls,uuilxmmmbus,cspcm'fiyamnmvd1idzm '
`HM;
`gym";
`":5
`mg
`
`
`
`
`
`“mm“
`1“ a
`"in
`cm n: we ‘Searcn' mum
`,
`«1%me
`Emma’mm
`”5‘93“ ”“5"“ me 9“" “EV-
`[mimic Engiii fiamOflIEaglfl'soe slwiexs -fl‘chppalflll- uflndlrlfinm[null]
`same cumpnunfl Wolds (We nus +
`
`snag .9pron
`mm mm, m WWSflE u,
`.
`,
`,
`,
`mm" ”'9’” “W" “”99” W‘
`me “New" M M9,. W
`Th: AmmanW Dmanary emcfinghshI‘f‘w' mi.EdIImWPFIEM ©2020 by
`
`mm mm in me Search liar Forhem resulis wiln compound
`Magnum Hzcclnt Pihllhmg Company, Altnglfls menu:
`wards. mace a mutation mam
`heme me oamuminu warn IH
`me seam WINIW
`lndo-European & Semitic Roots Appendices
`mmmm’
`Thu-mummixma'esinme difinmhmzflymmgbsfldmmrnmmh
`
`Shae NE!
`
`six
`
`"-9 newmel‘m" ”“899
`(mics andmid
`menaw sun is mmavaEame
`
`THEANER‘KLAN
`HERHAGE
`DKTI'IDMARV BLOG
`The anicies in an: n
`amine
`new mm: mm :gfimms.
`”New” ImagesMNm m
`emon‘ fllscilsslnils orusage.
`and more
`
`

`

`intus 1m ahdmiumrv mvfitwuldi Burch 5.1mm; i
`
`T marzmumfis 1D'AM
`
`THE 100 WORDS'
`See mm "sum-n nae hesl»
`Sung 1me135 SEES!
`“wanna-Imus;b
`
`maxnot me Dimmalv sway
`
`i? HEUSAGEPMEL
`me “we Panel Is a 9mm 3?
`mm momma-1mm:
`«www.makts,
`u'uwmts. ammelsin
`nan-mans mu mm at
`Imam Mmalsllvevs have
`“mmammm
`mmafld
`Wmmmls.
`mm’
`
`mNam Arum-.1 a!
`
`DEEDIIELFHMME
`ACW
`FUZHE’
`mhwruwmnm
`mmmmmm
`malmmnwammasuua
`flammammmu
`sums.
`
`

`

`
`
`mt 3 #www {uxsu erfi Enm/ 12/15QD18 m 55 35 AM
`
`
`
`
`
`

`

`Hugs #www fnxsugerfi Enm/
`
`12/152018 m 55 30 AM
`
`PLAY FOR FREE
`Terry ‘5 gimng away \aads nl cash each week.
`Submn your Free entry 10r a chance ED wifl $250,000!
`
`PREDICT 6 GAMES
`Make quxck predxcuons about what you think wm
`happen in each of six games.
`
`J
`
`WIN REAL ASH
`Get aH s‘ ' pi
`right to win the $250.000jackpm! If
`nobody hm; the jackpot you can win thousands of
`doHars in guaranteed prizes.
`
`Reggfirs m0“;
`41>.
`
`

`

`Hugs #www fnxsugerfi Enm/
`
`12/15QD18 m 55 35 AM
`
`9%an???
`
`WHAT'S BETTER THAN
`
`FOOTBALL & FREE
`CASH?
`
`Download the FOX Spons Super 6
`app now to join all the action.
`’
`DDWNGad my [He
`\ DENNHIDEU UH
`. App Store
`>’ Google ptay
`
`
`
`Anny
`
`35
`Michigan
`
`17
`Texas MM
`28
`Clemson
`
`
`1-}, Nebraska
`35
`“3;;
`,
`m I h;
`
`
`E’ Colorado
`21
`14.17
`, usc
`21
`w. v%’
`Q
`3
`Ti“ Stanford
`14
`
`
`
`7’9
`
`GAMES FOR ALL YOUR FAVORITE
`SPORTS
`
`ViE‘I’lBRERMPDWN
`
`‘
`
`“*h/
`
`::
`::5
`[IE]
`
`rq
`ht
`
`l—I
`
`LFDDTEJILL
`
`\Fox“
`
`e Flutes
`
`F‘nv‘acy F’ohq
`
`FLEX Bet
`
`

`

`To:
`
`Subject:
`
`Sent:
`
`Sent As:
`
`Attachments:
`
`Fox Media LLC (foxtrademarks@fox.com)
`
`U.S. Trademark Application Serial No. 88631059 - FOX SPORTS SUPER 6 - 81409013
`
`December 15, 2019 12:28:31 PM
`
`ecom122@uspto.gov
`
`United States Patent and Trademark Office (USPTO)
`
`USPTO OFFICIAL NOTICE
`
`Office Action (Official Letter) has issued
`on December 15, 2019 for
`U.S. Trademark Application Serial No. 88631059
`
`Your trademark application has been reviewed by a trademark examining attorney.  As part of that review, the assigned attorney has
`issued an official letter that you must respond to by the specified deadline or your application will be abandoned.  Please follow the
`steps below.
`
`(1)  Read the official letter.
`
`(2)   Direct questions about the contents of the Office action to the assigned attorney below.   
`
`/Ryan Witkowski/
`Examining Attorney
`Law Office 122
`(571) 272-7584
`ryan.witkowski@uspto.gov
`
`Direct questions about navigating USPTO electronic forms, the USPTO website, the application process, the status of your
`application, and/or whether there are outstanding deadlines or documents related to your file to the Trademark Assistance Center
`(TAC).
`
`(3)  Respond within 6 months (or earlier, if required in the Office action) from December 15, 2019, using the Trademark Electronic
`Application System (TEAS).  The response must be received by the USPTO before midnight Eastern Time of the last day of the
`response period.  See the Office action for more information about how to respond
`
`GENERAL GUIDANCE
`·         Check the status of your application periodically in the Trademark Status & Document Retrieval (TSDR) database to avoid
`missing critical deadlines.
`
`·        
`
`Update your correspondence email address,
`application.
`
`if needed,
`
`to ensure you receive important USPTO notices about your
`
`·         Beware of misleading notices sent by private companies about your application.  Private companies not associated with
`the USPTO use public information available in trademark registrations to mail and email trademark-related offers and notices –
`most of which require fees.   All official USPTO correspondence will only be emailed from the domain “@uspto.gov.”
`
` 
` 
` 
` 
` 
` 
` 
` 
`   
` 
` 
`   
`