`
`Ref
`#
`
`Hits
`
`Search Query DBs
`
`Defa
`ult
`
`Plurals
`
`Time Stamp
`
`Oper
`
`ator
`
`((("Jay") near3 ("Gregory") near3 ("D"))). US-PGPUB; OR
`INV.
`USPAT;
`USOCR
`
`((("Elsaid") near3 ("Khaled"))).INV.
`
`((("Lubris") near3 ("LLC"))).AS,AANM.
`
`US-PGPUB; OR
`USPAT;
`USOCR
`
`USPAT
`
`OR
`
`68247"P20090104148"P20090155200"P20
`100092484"P20100204087H"20120052077"
`|"20130039865"P20130116186H"20130315
`973"P20140179611H"20160250286H"2016
`0304572H"20170246246H"20170312335"P
`20180015141H"20180140546"P6433142"P
`6743774H"6960562H"7001881"P7030233H
`"7361738H"7415381"P7618941"P7642236"
`P8026346"P8506944"P8551467"P8563028
`"P8680057"P8945604"P8980840"P910788
`5"P9138457H"9248161H"9393285H"94212
`41H"9585936H"9730865"P9730978"P9982
`
`027")PN.
`
`
`
`OFF
`
`OFF
`
`OFF
`
`OFF
`
`OFF
`
`OFF
`
`2020/10/01 08:32
`
`2020/10/01 08:33
`
`2020/10/01 08:33
`
`2020/10/01 08:37
`
`2020/10/01 08:37
`
`2020/10/01 08:37
`
`
`
`
`
`
`
`L1
`
`L2
`
`L3
`
`L4
`
`L5
`
`L6
`
`47
`
`5
`
`9
`
`20
`
`57
`
`49
`
`
`
`((("Lubris") near3 ("LLC"))).AS,AANM. US-PGPUB; OR
`USPAT;
`USOCR
`
`I1 or |2 or I4 US-PGPUB; OR
`USPAT;
`USOCR
`
`("20090191287"|"10125180"|"10383796"|"2 US-PGPUB; OR
`0060240037"|"20070111327"|"2007024955 USPAT
`
` 7"P20080139458"P20080287369"P200900
`
`
`
`
`
`
`
`10/1/2020 8:59:46 AM
`C:\Users\|komatsu\Documents\EAST\Workspaces\15808632—RCE.wsp
`
`Page 1
`
`
`
`EAST Search History (Prior Art)
`
`L7
`
`L8
`
`L9
`
`L10
`
`
`
`
`
`49,272
`
`Gln adj Asp adj Leu adj Ser adj Ser adj Cys
`adj Ala adj Gly adj Arg adj Cys adj Gly adj
`Glu adj Gly adj Tyr adj Ser adj Arg adj Asp
`adj Ala adj Thr adj Cys adj Asn adj Cys adj
`Asp adj Tyr adj Asn adj Cys adj Gln adj His
`adj Tyr adj Met adj Glu adj Cys adj Cys adj
`Pro adj Asp adj Phe adj Lys adj Arg adj Val
`adj Cys adj Thr adj A|a adj Glu adj Leu adj
`Ser adj Cys adj Lys adj Gly adj Arg adj Cys
`adj Phe adj Glu adj Ser adj Phe adj Glu adj
`Arg adj Gly adj Arg adj Glu adj Cys adj Asp
`adj Cys adj Asp adj A|a adj Gln adj Cys adj
`Lys adj Lys adj Tyr adj Asp adj Lys adj Cys
`adj Cys adj Pro adj Asp adj Tyr adj Glu adj
`Ser adj Phe adj Cys adj A|a adj Glu adj Val
`adj His adj Asn adj Pro adj Thr adj Ser adj
`Pro adj Pro adj Ser adj Ser adj Lys adj Lys
`adj A|a adj Pro adj Pro adj Pro adj Ser adj
`Gly adj A|a adj Ser adj Gln adj Thr adj Ile
`adj Lys adj Ser adj Thr adj Thr adj Lys adj
`Arg adj Ser adj Pro adj Lys adj Pro adj Pro
`adj Asn adj Lys adj Lys adj Lys adj Thr adj
`Lys adj Lys adj Val adj Ile adj Glu adj Ser
`adj Glu adj Glu adj Ile adj Thr adj Glu adj
`Glu
`
`gout or pseudogout or (pseudo near2 gout)
`
`$QDLSSCAGRCGEGYSRDATCNCDYNCQHYM
`ECCPDFKRVCTAELSCKGRCFESFERGRECDCD
`
`AQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
`PPSGASQTI KSTI'KRSPKPPNKKKTKKVIESEEI
`TEEH SVSENQESSSSSSSSSSSSTIRKIKSSKNS
`AANRELQKKLKVKDNKKN RTKKKPTPKPPWDE
`AGSGLDNGDFKV'I'I'PDTSTI'QHNKVSTSPKlTI'
`AKPINPRPSLPPNSDTSKEI'SLTVN KEITVEI'KE
`
`'I'I'I'I'N KQTSTDG KEKTFSAKEFQSIEKFSAKDL
`APTS$
`
`I5 and I8
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`OR
`
`ON
`
`2020/10/01 08:39
`
`
`
`OR
`
`OR
`
`OR
`
`
`
`ON
`
`ON
`
`ON
`
`
`
`
`
`2020/10/01 08:40
`
`2020/10/01 08:41
`
`2020/10/01 08:42
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`
`IBM_TDB
`
`
`
`10/1/2020 8:59:46 AM
`C:\Users\|komatsu\Documents\EAST\Workspaces\15808632—RCE.wsp
`
`Page 2
`
`
`
`EAST Search History (Prior Art)
`
`l6 and I8
`
`OR
`
`ON
`
`2020/10/01 08:46
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`
`
`OR
`
`OR
`
`OR
`
`OR
`
`
`
`ON
`
`ON
`
`ON
`
`ON
`
`
`
`2020/10/01 08:48
`
`2020/10/01 08:49
`
`2020/10/01 08:51
`
`2020/10/01 08:52
`
`
`
`L12
`
`L13
`
`L14
`
`L15
`
`L16
`
`
`
`
`
`2,986
`
`1,577,
`694
`
`275
`
`(proteoglycan near2 "4") or lubricin or (prg
`near2 "4") or (superficial adj zone adj
`protein) or (megakaryocyte adj stimulating
`adj factor adj precursor) or szp
`
`l8 same I13
`
`mature or preprotein or precursor or (leader
`adj sequence) or (signal adj sequence) or
`(signal adj peptide) or (leader adj peptide)
`
`I13 with |15
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`
`IBM_TDB
`
`
`
`10/1/2020 8:59:46 AM
`C:\Users\|komatsu\Documents\EAST\Workspaces\15808632-RCE.wsp
`
`Page 3
`
`