throbber
EAST Search History (Prior Art)
`
`Ref
`#
`
`Hits
`
`Search Query DBs
`
`Defa
`ult
`
`Plurals
`
`Time Stamp
`
`Oper
`
`ator
`
`((("Jay") near3 ("Gregory") near3 ("D"))). US-PGPUB; OR
`INV.
`USPAT;
`USOCR
`
`((("Elsaid") near3 ("Khaled"))).INV.
`
`((("Lubris") near3 ("LLC"))).AS,AANM.
`
`US-PGPUB; OR
`USPAT;
`USOCR
`
`USPAT
`
`OR
`
`68247"P20090104148"P20090155200"P20
`100092484"P20100204087H"20120052077"
`|"20130039865"P20130116186H"20130315
`973"P20140179611H"20160250286H"2016
`0304572H"20170246246H"20170312335"P
`20180015141H"20180140546"P6433142"P
`6743774H"6960562H"7001881"P7030233H
`"7361738H"7415381"P7618941"P7642236"
`P8026346"P8506944"P8551467"P8563028
`"P8680057"P8945604"P8980840"P910788
`5"P9138457H"9248161H"9393285H"94212
`41H"9585936H"9730865"P9730978"P9982
`
`027")PN.
`
`
`
`OFF
`
`OFF
`
`OFF
`
`OFF
`
`OFF
`
`OFF
`
`2020/10/01 08:32
`
`2020/10/01 08:33
`
`2020/10/01 08:33
`
`2020/10/01 08:37
`
`2020/10/01 08:37
`
`2020/10/01 08:37
`
`
`
`
`
`
`
`L1
`
`L2
`
`L3
`
`L4
`
`L5
`
`L6
`
`47
`
`5
`
`9
`
`20
`
`57
`
`49
`
`
`
`((("Lubris") near3 ("LLC"))).AS,AANM. US-PGPUB; OR
`USPAT;
`USOCR
`
`I1 or |2 or I4 US-PGPUB; OR
`USPAT;
`USOCR
`
`("20090191287"|"10125180"|"10383796"|"2 US-PGPUB; OR
`0060240037"|"20070111327"|"2007024955 USPAT
`
` 7"P20080139458"P20080287369"P200900
`
`
`
`
`
`
`
`10/1/2020 8:59:46 AM
`C:\Users\|komatsu\Documents\EAST\Workspaces\15808632—RCE.wsp
`
`Page 1
`
`

`

`EAST Search History (Prior Art)
`
`L7
`
`L8
`
`L9
`
`L10
`
`
`
`
`
`49,272
`
`Gln adj Asp adj Leu adj Ser adj Ser adj Cys
`adj Ala adj Gly adj Arg adj Cys adj Gly adj
`Glu adj Gly adj Tyr adj Ser adj Arg adj Asp
`adj Ala adj Thr adj Cys adj Asn adj Cys adj
`Asp adj Tyr adj Asn adj Cys adj Gln adj His
`adj Tyr adj Met adj Glu adj Cys adj Cys adj
`Pro adj Asp adj Phe adj Lys adj Arg adj Val
`adj Cys adj Thr adj A|a adj Glu adj Leu adj
`Ser adj Cys adj Lys adj Gly adj Arg adj Cys
`adj Phe adj Glu adj Ser adj Phe adj Glu adj
`Arg adj Gly adj Arg adj Glu adj Cys adj Asp
`adj Cys adj Asp adj A|a adj Gln adj Cys adj
`Lys adj Lys adj Tyr adj Asp adj Lys adj Cys
`adj Cys adj Pro adj Asp adj Tyr adj Glu adj
`Ser adj Phe adj Cys adj A|a adj Glu adj Val
`adj His adj Asn adj Pro adj Thr adj Ser adj
`Pro adj Pro adj Ser adj Ser adj Lys adj Lys
`adj A|a adj Pro adj Pro adj Pro adj Ser adj
`Gly adj A|a adj Ser adj Gln adj Thr adj Ile
`adj Lys adj Ser adj Thr adj Thr adj Lys adj
`Arg adj Ser adj Pro adj Lys adj Pro adj Pro
`adj Asn adj Lys adj Lys adj Lys adj Thr adj
`Lys adj Lys adj Val adj Ile adj Glu adj Ser
`adj Glu adj Glu adj Ile adj Thr adj Glu adj
`Glu
`
`gout or pseudogout or (pseudo near2 gout)
`
`$QDLSSCAGRCGEGYSRDATCNCDYNCQHYM
`ECCPDFKRVCTAELSCKGRCFESFERGRECDCD
`
`AQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
`PPSGASQTI KSTI'KRSPKPPNKKKTKKVIESEEI
`TEEH SVSENQESSSSSSSSSSSSTIRKIKSSKNS
`AANRELQKKLKVKDNKKN RTKKKPTPKPPWDE
`AGSGLDNGDFKV'I'I'PDTSTI'QHNKVSTSPKlTI'
`AKPINPRPSLPPNSDTSKEI'SLTVN KEITVEI'KE
`
`'I'I'I'I'N KQTSTDG KEKTFSAKEFQSIEKFSAKDL
`APTS$
`
`I5 and I8
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`OR
`
`ON
`
`2020/10/01 08:39
`
`
`
`OR
`
`OR
`
`OR
`
`
`
`ON
`
`ON
`
`ON
`
`
`
`
`
`2020/10/01 08:40
`
`2020/10/01 08:41
`
`2020/10/01 08:42
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`
`IBM_TDB
`
`
`
`10/1/2020 8:59:46 AM
`C:\Users\|komatsu\Documents\EAST\Workspaces\15808632—RCE.wsp
`
`Page 2
`
`

`

`EAST Search History (Prior Art)
`
`l6 and I8
`
`OR
`
`ON
`
`2020/10/01 08:46
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`IBM_TDB
`
`
`
`OR
`
`OR
`
`OR
`
`OR
`
`
`
`ON
`
`ON
`
`ON
`
`ON
`
`
`
`2020/10/01 08:48
`
`2020/10/01 08:49
`
`2020/10/01 08:51
`
`2020/10/01 08:52
`
`
`
`L12
`
`L13
`
`L14
`
`L15
`
`L16
`
`
`
`
`
`2,986
`
`1,577,
`694
`
`275
`
`(proteoglycan near2 "4") or lubricin or (prg
`near2 "4") or (superficial adj zone adj
`protein) or (megakaryocyte adj stimulating
`adj factor adj precursor) or szp
`
`l8 same I13
`
`mature or preprotein or precursor or (leader
`adj sequence) or (signal adj sequence) or
`(signal adj peptide) or (leader adj peptide)
`
`I13 with |15
`
`US-PGPUB;
`USPAT;
`USOCR;
`FPRS;
`EPO; JPO;
`DERWENT;
`
`IBM_TDB
`
`
`
`10/1/2020 8:59:46 AM
`C:\Users\|komatsu\Documents\EAST\Workspaces\15808632-RCE.wsp
`
`Page 3
`
`

This document is available on Docket Alarm but you must sign up to view it.


Or .

Accessing this document will incur an additional charge of $.

After purchase, you can access this document again without charge.

Accept $ Charge
throbber

Still Working On It

This document is taking longer than usual to download. This can happen if we need to contact the court directly to obtain the document and their servers are running slowly.

Give it another minute or two to complete, and then try the refresh button.

throbber

A few More Minutes ... Still Working

It can take up to 5 minutes for us to download a document if the court servers are running slowly.

Thank you for your continued patience.

This document could not be displayed.

We could not find this document within its docket. Please go back to the docket page and check the link. If that does not work, go back to the docket and refresh it to pull the newest information.

Your account does not support viewing this document.

You need a Paid Account to view this document. Click here to change your account type.

Your account does not support viewing this document.

Set your membership status to view this document.

With a Docket Alarm membership, you'll get a whole lot more, including:

  • Up-to-date information for this case.
  • Email alerts whenever there is an update.
  • Full text search for other cases.
  • Get email alerts whenever a new case matches your search.

Become a Member

One Moment Please

The filing “” is large (MB) and is being downloaded.

Please refresh this page in a few minutes to see if the filing has been downloaded. The filing will also be emailed to you when the download completes.

Your document is on its way!

If you do not receive the document in five minutes, contact support at support@docketalarm.com.

Sealed Document

We are unable to display this document, it may be under a court ordered seal.

If you have proper credentials to access the file, you may proceed directly to the court's system using your government issued username and password.


Access Government Site

We are redirecting you
to a mobile optimized page.





Document Unreadable or Corrupt

Refresh this Document
Go to the Docket

We are unable to display this document.

Refresh this Document
Go to the Docket