throbber
— Windows—
`
`Vista
`
`
`
`The book
`thet should
`have been
`in the box
`
`POGUE PRESS”
`O’REILLY*
`
`“Pogue, the New York
`ieeeeel cig
`columnist, is among
`
`armelale BM er-t-a8 explainers.”
`
`—Kevin Kelly,
`
`co-founder ofWired
`
`e
`
`LiTL Exhibit 2010
`
`HP Inc. v. LiTL
`IPR2024-00404
`David Pogue
`
`

`

`
`
`

`

`COLLEGEVILLE, MN56324|
`
`ALCUIN LIBRARY |
`
`ST. JOHN'S UNIVERSITY
`
`

`

`
`
`
`WindowsVista
`
`THE MISSING MANUAL
`
`The book that
`should have been
`in the box®
`
`

`

`
`
`

`

`WindowsVista
`
`
`
`David Pogue
`
`* Taipei
`
`* Tokyo
`
`POGUE PRESS"
`O’REILLY*
`Beijing * Cambridge * Farnham * Kéln * Paris * Sebastopol
`
`
`
`

`

`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`WindowsVista: The Missing Manual
`by David Pogue
`
`Copyright © 2007 David Pogue.All rights reserved.
`Printed in the United States of America.
`
`Published by O'Reilly Media, Inc., 1005 Gravenstein Highway North,
`Sebastopol, CA 95472.
`
`O’Reilly Media books maybe purchased for educational, business, or sales
`promotional use. Online editions are also available for most titles: safart.oreilly.
`com. For more information, contract our corporate/institutional sales department:
`800-998-9938 or corporate@orellly.cam.
`
`January 2007:
`February 2007:
`
`‘First Edition.
`Second Printing.
`
`The Missing Manual is a registered trademark of O'Reilly Media,Inc. The Missing
`Manual logo, and “The book that should have been in the box”are trademarks of
`O'Reilly Media, Inc. Manyofthe designations used by manufacturers and sellers
`to distinguish their products are claimed as trademarks, Where those designations
`appear in this book, and O'Reilly Mediais aware of a trademarkclaim, the
`designations are capitalized,
`
`While every precaution has been takenin the preparationofthis book, the
`publisher assumes noresponsibility for errors or omissions, or for damages
`resulting fromthe use of the information containedinit,
`
`>
`di
`RepKover.
`Messe This book uses RepKover’’, a durable and flexible lay-flat binding.
`
`
`
`ISBN-LO: 0-596-52827-2
`
`ISBN-13; 978-0-596-52827-0
`
`
`
`

`

`QA
`76.76
`.063
`P63525
`
`2007
`
`Table of Contents
`
`The Missing Credits.............-sseeasiaslbaaieamean sacaisteeisaninasnlpvabiciaetiies
`
`MtrOQUctiOM ........0cc0sceccseeceeesessesesesecsenssseeeess saiageneataanaddcamsnerendaouaavale
`
`xi
`
`1
`
`
`
`
`
`
`
`
`
`36
`Start—-Computer........
`DialRecent NENSassonian iaaen 37
`SAIL5SAAT sce cancion viva taenanban eleven ctsceihlaicuinne anuaeaneloonnassaewtiies
`37
`SOUT5GSTIS asst recast ccna diana anal pcae A edad aeovesinahdd imap ocdreneeRieoaMantela
`38
`
`Part One: The Vista Desktop
`19
`Chapter 1: Welcome Center, Desston;aand the Start Menu.............
`19
`The Welcome Center...
`rei
`anima
`22
`The Vista HeskinpaNow.war Aeol-
`
`24
`The Start Menu...
`
`
`28
`What's in the Start Menu ...
`
`
`i500
`Start (Sleep)...
`anamnmcas
`
`
`StetCLM) ssscicssssccsssccsesccssstscanacttasaccncccitttaastactcecacceptetcecatescoco 32
`
`
`Start—>Log Off, Restart, Hibernate, Shut DOWM wesccccssccseccsessssosssssnsssssusussssenssessccsssisenesnaanses
`D2
`
`SaintsHela Garde Seip sass casssssissdyscztsaovonyasy ShsubissascsvaaedSbcecscpvosvdponbatadciviaqanponsbausccstsnjantounnievios
`34
`
`Stark—sTeTAU TE Prastayed scanaccispsesanrstsnssvccsjoqnbsbisoursdcors etssssondeayyynbosvisosastzpreyybathnsirstnanesseossibaeuantaton
`34
`
`SatsCONTPanel ya sntertarrecenaiouameeereme bawednniemeemnaenpeeiok
`oo
`
`
`StartConnect To......
`35
`Start—Network.....
`35
`
`
`
`
`
`
`
`
`
`
`
`38
`Starts UUSIG, PRCT ES vasesdarsalics Tess comnitctvacreatnns att lvenmaiUieramieilvirciahs jean presenbieesniiomanetestesiecettay)
`39
`Start—Documents...
`er
`os
`
`39
`Start—>[Your Name]: The!personalFolder...ae
`40
`ww.
`Start—Run...
`saci aaaastsas iT
`
`CustomizingtheStart ide.nSMEoecabab 44
`Chapter 2: Explorer, Windows, and the Taskbar...........sventasapcauicn
`57
`Universal Window Controls .....-cccccsssssssssesessessessecescssssssseeesacessessssssrnnnnttsetssesonnennnsennnenesecceensngeqceeqean
`57
`Explorer Window: COMPOS:.i:.+.cccumoiassssnsaicssnsnanacuseconajusnpeidssuniahasiaiouonsbucbtasScsssotacarqcassnuivoyes
`60
`Optional Window Panes.............
`63
`Tags, Metadata, and Properties.
`69
`
`Icon and List Views... ap.|call
`
`Sorting, Grouping, Stacking, andFitetlig ec
`siaiitisiugpiidaiaanspdiabsita
`75
`
`Unni-Window vs. Multi-Window...cccsccssssecsssssseecssssussssssseessssecessccsessesssnensnnnmuenssssnnecereesesesesssessssssensas
`80
`ImmortaliZing YOUF TWeaKS........sesssseseecseeecesnsessssueeneesseieesinmimiisrs
`Bl
`The Folder: Opntioris”Oi ttvcissceiainansjanssnarsieonyinsnnarcessuncavanuxsasaserennsenpesiiunsnusesoreccutseenvnonansyenencs
`82
`
`
`
`
`
`
`
`TABLE OF CONTENTS
`
`
`
`

`

`
`
`
`
`
`
`
`
`
`Sizing, Moving, and Closing WindOWS j...essssssssssssssssvvsrssessssssvusesssersneneeseesornseeeeeenscessersqeisesanavsssensest
`WWarncheoys FHA CARETea) siiccs aca scvcocu vada Gd snvnygnnvenseanecbovewsepscvdlicieaiga bsbbaencvbanatiynbawy
`FNALVS: FUP Dabs nc isizcsnnensors adnantenacnaCdndc\vinausachnt vides O13 vaapssioeeso seins ee mebaba aNmane
`ITH FSRDea tesrescindrandrenHE ERTENrive ey aRurs mE AAETY,
`Taskbar TOOtbars.........ssssnssssssvccsssssseseasesessesssssecsnsesssnnnssesrseesesesssessssssnayssossasnenseesesipegesseenseessensssssenssssey
`
`86
`89
`90
`Moe
`98
`
`Chapter 3: Searching and Organizing YourFiles...
`wo 105
`
`Meek Vistas Searchyssasiscssssases iscssvssessanasessoasvaseatzoetasenai qovvennsovosbvanispodace
`awe
`106
`
`
`
`Secarchy Forma ee SBE MEME sovssasseccisnsssisiosscsasarouatsanconsyraanogoeheescscnnnounisooutieadcannossecbpedddandonsainiacevatiaetad 106
`
`
`
`Explorer-Window SearcheS....sssssssssssssssssssssscscssssssssssnsssssessessessesssssssnnssssunsnssssseuseensteesessssttsessess
`119
`Saved Searches (Search FOIeLS).....csssssmseseersonesssnrssssessnsesssetssessesssseeuasesstessssssespsetsssnesestsoneseetsaneeees
`123
`
`The Folders of Windows Vista ....ssisssscssssssssssssescssnssssssseessnssesseseseosissssssnessssseesssescesnsisunssccsrssenaseees—[26
`
`
`Bike WHEE ACO IS icicssisscsevciiarecassnssawsesasscaontssestvceieanoii tnesk oawaetLtitakasts ca ustbni bane aaaea OrinCCaNadiG
`130
`
`SLSRLCOS eis cccvasseccccsnpasscestpastqctosussecssapeliscscanmasslppestiibereeoedspltcas bab scenbabpaintoabassdoccsaseSstSa aoe
`136
`Copying and ee Frenlclearschtick FAVESoccassassesapconacnntccaonpiepeyuanncsapasbansccsiaeavsseescallantonh 138
`
`
`
`
`Tiree Rectch Bainseesaai 141
`
`
`
`SUAOT ECUEE [COURS suisatseanbisdcasersponshcotddesadeapvnnstvusdSunestSStrucdendswrigsddpeadtignasscartadaatinestabeypisanitdlayoivetes 145
`
`Compressing FilesandFolders
`TianSEERaniemeaimteenan NAP
`
`Burning CDs and DVDsfrom the Desktop[ReaBirtaoot,rere 151
`
`
`Chapter 4: Interior pereETVREinacinscominmmcminnmacnn 157
`TOE
`Aero or Not...
`aivasiisdsflimsiciestaaauarigeosaniusdguaioanpnusehiasaus valdeiainonlannindaciricagpeonieamemanauuenen”
`
`Dialing Up YourOwn Look...sSceaines
`160
`
`Desktop Background (Wallpaper)...
`163
`
`
`SCFEOM SAVETS....sssseccsesnneesssapseneeessssnsecs
`165
`
`
`
`
`SOUNAS visseecceses
`167
`
`
`
`
`
`IGMMKCOVER sicasaassssvsusczacinesoneneuaxacasseennescaaabasrcsacccsassaSousdiaansoncbstaneccisabanceuabanaLsaneobhcbobae 167
`
`hare: VOUT TMGG icsccsssccssscctsccesicstinasectvenseccceterrceeccaayaescnccacaaeaaoalanataasactbnsnlatDae
`170
`IVMCOFAUECO SULENNGRS 3 ics; cystvpaia ani sascha eben Sana aa bigbcodaadapenneNNSRAGoES m
`
`
`
`
`
`Chapter 6: Programs, Documents, and Gadgets.........ss0sssesersve. 189
`
`
`ASATge FREUTAECUSciccasccasulisécaneeatdjasaiosacvesscGesnetosslbogkinscdstonolapseeesseanoaSinialanaanieocotepasbliveenel 189
`
`
`ENXiting PrOgramm......sssccsssssssssssssssassssussssees vey:|FOO
`
`
`When ProgramsDie: The Task Manager...
`neUUesiseaMinnie: TOD
`
`SAVIN DOCUTANESSccsscansasnnecieaonaemaaascernsensasncaisasanizmannsnaeitaasiinsinerAMARITNRERMATTERTINOATAISTDS
`194
`
`COSI& PUGCLIMENES ssccssscascccscissexevavcamcnasaxascovceetancccsssvsswauoociananvecnncastbacssakckimuiniusaassivebssnbbsibcctsbadp
`198
`
`DENG: CORY EMage ERRstacancpizssseasccraypnopencdRNGUSARSQNCARTERORIEN 198
`
`Moving Data Between Document .......:ssssessesssssesssseccnutseerssssvensessssttbneesssscesssenpnibsbecseaesisteevesdnuesians
`199
`
`Speech: RECONthOnnsicsacisasastaatasessiaboneslanaiaavoacaonbedakeaaisssjoan bealddaawnatesaaiinniolabeconsbine
`202
`
`TEL SHCAEDA Eater rts alegre vanancev Donato ereanendlaBt bd alaS GAL Octane ceeesBIaaeasosttpapo
`21)
`
`
`
`TABLE OF CONTENTS
`
`
`
`
`
`Chapter 5: Getting Help............seethneachpetainstatnphatteliehannctayAteseten 175
`Navigating the Help Systermasissiaissvsississscovssscsonssiiecanvaidinsisinnniaisssciusnssivionsianastausasonisiaacessonn ienisaas
`75
`
`Remote Assistance........:...:sscces
`178
`Getting Help from Microsoft.....cissscssiissccsccssonsessesscessaseseccscdousssssessnesutussvasenenesossteqnescynronnnnepaivenaeentsess
`185
`
`Part Two: Vista Software
`
`
`
`

`

`Filename Extensions and File ASSOCIatiONS.........ssoovss:ssssscssssseoscsssesssssssssnnssssedsecssssseneseseresesssssesseane
`Installlite Softeressacsescsesenesvictmrescssssscsasasccctatcccoatacusaagaceckadeancoeeaubbanbivaaniaiwbebecenclonanabssiiaens
`Urvitysstealtracy Secttutenisc:sanessceucaeecavaccasnsvatpaancaantacbusssasoesansoneoueanswaaniprpelicassainnnbiataaanneae
`RUNMINg Pre-Vista Prograrns.......ssssesesessseeesesecesensenenesssrssnsessceeeeeeseesnsnnonsnsvessayessensessesussenseesssonansnaseses
`
`22]
`22S)
`233
`236
`
`
`
`Part Three: Vista Online
`
`
`
`
`Chapter 7: The Freebie Software........sscsssssssssscssssssessessssnsessnesnenneeneess 239
`
`Default Programs... sensioceanenon aN 239cian
`
`
`
`Internet Explorer......
`ae
`
`
`240
`Witidows Calendar?cicscsvavinasinasancasaridwasuiiconaminiiilpiiapunnidedeeummmnunwigl
`
`
`250
`WINGOWS COTWeatisiscisccsiisstensiaicsanpsiciiiwicciaiscaaialsiisitd icin ieiniiindionimimanianaansuana-
`
`Fee
`WATchesWes COTEFENEH 5s iscsicsssSizsaa tht oticerantCiiticrsacaivindagnaiianetiatsmniglieaheantinentiominsinmetamnniiinemin.
`
`Windows DVD Maker...
`icdiceonsToapinia lsdleooenaniarrnamaehioanniON IeRIENERERTN EE
`Windows Fax and Sins,
`EeelpsetoiupcasszeseussenyyouttouaxausiorengasnsPoemugenrnronsnenestieioincavsrrasacoaines BE
`
`WindowsLive MessarigerDownload.
`siaisipipieentgi
`252
`
`
`Windows Mail ...eccesssecees
`si enavablga
`252
`
`
`
`Windows Media Center. ...sssssssissssscessssnussssssssescscssveessnsseenssnseescecsnscersrveseessnsonueecersvsvesersevverenrssverenesaras
`253
`
`Wimeoowes Media Playerisssissscissssicsstcicscccsoosissasasbssoccciccspncnndsausbass4iaaaggegbuipessscoscitsnoasssaiaaaaiacsebsedsvived
`253
`Windows Meeting Space............cccsssessssssssssssssssssessessesssssnnuesscseessssateeceesseeesssnnssnanessscsesseessnees—205
`
`Wires Movie MakBt?<5 scares snscrcmavnnrasisroaeenasiwanlspmaniets arse ieamiieneaeiemrivamarieor an 253
`
`
`Windows Photo ooasheiilenaasstlesonsaonssunstaucapacnpulvanasiaergmemeummbteciicsnienaIeDaaSOR
`253
`
`253
`ceeevensiinnuaaas ssn wieneiasninssizia mas vviiasaabanuveusbaueneiaad weve nes
`Wri: Ci podte sisi csnsavsazsssnnsnesisonia
`
`
`
`Accessories... cscs ARLESERENATAGGRASS ENB SN vO a COBURG TRUSSO RGA REET 253
`
`
`Extras and Upgrade.
`ati
`273
`
`
`
`GoM OS asiidaeacinnianenauiandanannmai maaan nese
`‘
`
`
`
`
`
`MestIWRextsicass csaneccin acbansiacsssovoabhaqptaetd vatacasabaounkinscoalbeasaaaesnaowadealiana 280
`
`SALEAERUID 5 Saicisscomnspnsidat icbgneskenppediiaaisilid estopaiaal pebtbdohinocabbatail Anema fi Umoncpaadamnyims ara ane epetecmauosioneel
`280
`
`
`
`
`Chapter 8: The Control Panel..........cscssssersssessstssseesesescensensaesesseesenes-. 281
`Home View: The Big Vista Change ........s.sssssssssvsssssseesseensessessennesssssssgsessesusessesseseceeesnesnsnnsesanessscsseesss
`281
`GCRGASSUG ATR isssvvaza eae iptstecs anewvelco RSSsRg aan Wicneaual ciate daniel
`285
`The Control Panel, Applet by Applet ...ucccccc.ccccssssssusssseeeesssensesecesseccsnnssssnssstseemmenenseteeeenee
`200
`
`
`
`Chapter 9: Hooking Up to the Intermet..............csssssersesseeeernees 319
`Broadband Connections (Cable Modems ard DSL) .n....sssssssssssssssssssnsssssssseeesssseaseeccerssssnsensonensessss
`319
`
`
`
`
`
`WYIRGLOSS: N@EWISRS. crasnssvcsconicrininbonatvovumcntsivvotssscaseiSouiuchdaiiihebbninethtZachWasnrebaaviasVOSDNSvended 320
`
`
`
`
`
`
`
`
`
`DidbU p COMMCCHOTS saccssvcssniniiisatanicciasativcicsscaiiiceuaiidiestviersiaasicueiioobicuccicneoeecasnasanstasaaaait 321
`
`
`GOA MCLMa NBRERIE NIE ceesscesisnvsevsspevvacdenreeoetonhakadesvecdomatiicoann teva Noes ts
`Bleahlabs ANNRRE
`OaUehaice
`325
`
`Deetantls: orn: DiaTHUD: sisutnnsisantsnsiiacstaccdsucassaavevivias taaiagetanel oniiveaareiioansn iia icanedinnn cain ain
`327
`
`
`Chapter 10: Internetet Sacryeletaefevpeiaaioncnetdalac SO
`Security Center...
`eer
`—KiRMCEE. Aan
`Windows FRPPananassae 336
`Windows Defer der cavczcssssinzsnntcaswarpiceicaasisvecsanseassessieiikaneiyppe@eeickuteeessp iomnkbeeanceaseisbabinttoten
`340
`
`The PhishingFilter........
`346
`
`Paarerie CraiecaseanynchiasiacbosscovnpernewearihLLli42iaunyasibidoonaeecabnaiassebinioieesdTiNi
`349
`
`
`TABLE OF CONTENTS
`
`
`
`
`
`
`
`
`
`
`

`

`
`SOD
`History: Erasing YOur Tracks..........cscsssessssssssssesssccssnssssenssessssssesccssnssssvessasssesetssuuesssssasesseesionesne
`BBO
`THe POPUp! BIGCKER; siicasisssnacciamsnnianniiananaaiiiicainannoinaiiiiciiminmnmminnciimeiien:
`
`357
`[anteserest SecATrt ZAMS sss izssscat nasa sppsnsbassstcbndevwayancuupudl iaysbsi pune dveab0bd apna vnepfobunsss eneuasebenige
`
`359
`Flot Sport Secuttiessssataicaanesiseasnncaseaisecaniniaiaicsaitacesicaneatonetaestcanatdaaecaaraderaestbemailliemenons
`
`Protect Your Home Wireless Network.......sssssssecccsssseessssessseseessenssnssssessessnseserstesseenssiatseetssne—300
`
`
`PesCHCA CIEEISTE, exces cionnnsrszenitcccocinonnczpernrstesensinnr etervoltoeimensreenGadnaneinepeaneneravomeae
`CEN
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`Chapter 11: Interneteee scvcisinpainseiieaarisahiaiaiabiaceagiants 367
`
`IE7: The Grand Tour...
`si
`
`Tabled Browysitssssecissisesasstsananissiisiiscspeiatinniitdaaenstuaasaciicacaanianaiees STS
`Favorites. CEGOKITALRS) «scsexeesssnessscsssrnnsiisessepobiveqnpaneteibvonrayeeneteteosanensiinyantamsonappebonoeororphantsstishpecgesesianct’ EG
`History List...
`en
`eysidaistetg EATSAHA TL ote EnsAEEEREGee
`RSS: The MissingManta. Seanaanneanna El
`Tips for Better SUFNEconsinunnac
`si
`
`
`The Keyboard Shortcut Master List .........ssssssssssssssssssesssesssssssssssseesesccacnciacestiganncinassSLeabOAR
`
`Chapter 12: Windows Mail ......cssssssssssssssssssssesnsesssesnssssarsessasassessesne SOT
`
`Setting Up Windows Mail.ssessssssssssessssssssssssssssesesssssessssesccessssesesssssesseesssessussiuattsssennuaysassssnnenssssseen
`392
`
`Sending Email...
`a
`
`402
`Beary Etiieccssscancvarscasassvncnseecasinssovainauccovaivasnapstvsanhwuneecsaspenpeeadsecareinbaesisecncceamtannspancecceaaneian
`41
`JET ENT IIT ss sccsonescscvneoeesuszésepetaaacaizaaz ph biceascaaascia Sasa ob panna goa
`Configuring Windows Mail evassssssssscssssesessoossssssnnnssssvuvsssessssnnesssnnnesssssssssuyesssevenscespesneesernnssesSees 414
`RMNREOIPOSS i cesses scsi aba scintch pup Snusa cannaSuan as a Doula aaa HOON aN nuaSONUoN 418
`
`Part Four: Pictures, Movies, and Media Center
`Chapter 13: Windows Photo Gallery ..................:::s:scsscssssssensesseessssees 423
`Photo Gallery: The Application ...ccccsssccssscssssssssssssssnssssssssssesssesssssassnsssssnsssssssssvunsececsesssesgeesenesssansassone
`423
`Getting Pictures into Photo Gallery.
`424
`
`The Post-DumpSlideshow..
`430
`
`The Digital Shoebox............
`w 432
`Behe SANDEL RRRNYBOS caccacacasiaiesszissscoalaceiesGeassancebuNWapusigpabbovesmuunsCeedeavaSa
`442
`Editing’ Vootntt St1cotss js:scsscccsccbyovvvccssccovensevevasasescecevnrbbenncveeobecaccenevoboshnasavasiomnietpresescecerenporennnvesasaai®
`446
`FAPibVOUAUHICINCEssosonesssassaisssasneszsiavicveesoiSeysonsetasenososertisisesnnegsanshesvitosentatenizenshoprcedsetidansnesssedge
`455
`
`Chapter 14: Windows Media Player..............ssscsssserssssssnseresssseenses 463
`Whe Lay of the ban ersscssscccptessssncecepreiccttenatcaeareaceeaeaanata 464
`Online Music Stores csccsasiannnnsnguamiimennsimacaorniininnnanmneARmmOiNEmN 477
`DVD MOvie........sessese
`w
`479
`
`
`Pictures and VidEOS......sssssssssesssusssss
`einen osaneiauat as eacams ea TTLATEapTKclona
`482
`ji444i
`lcci
`
`Chapter 15: Movie Maker and DVD Make.......ssscsssessessssssereeeseseens 483
`Importing Video, Music, amd PHOtOS ......cscc.::ssssescsssecccssssessssssseesesssssscesssesessensen saisonaa 483
`EetRUCDRe MICO sia saisinstecectyasonceleccnennsgswoeeusasshineegrass imarenaaeesiatanynoneriaienespeneinian “AEE
`DVD MOK sicininicincnicicinatiamnrnimimisinmemanumncmiinnamiaianes
`ASA
`
`
`
`
`
`
`
`
`
`
`
`
`TABLE OF CONTENTS
`
`
`
`
`

`

`Your Gear List...Atta
`
`SALUD vencinescmntn
`PME VOI PCS TAG5 secccossenccans vpn svt jusersnssecesusvncenoecoanveuneocsnssaceasencagnasocapiseedonnn seecatceatsmnasnseceanni ions
`RUSIce Voutr PG a J RODIXi ssiscssscccavseainsesisassussuccasscsaacaabensscuaidsia nvasaneiaicssbbisiaeatbeisasecnucspaveeaneiataisins
`PPRCARS PL LHsecaacacaasucacpus cacccc cctv 86scaNRUTTT ai ace MLR cana
`AccTiviarncd SMTNGS sescayzsccssscrsccccessceaegestSisncaesassacestaocanhangbadivedabendGvvasonmpebosbaatns
`
`
`
`
`
`
`
`Part Five: Hardware andPeripherals
`Chapter 17: Fax, Print, and Scan ............0.+.ciancaiCivsani 533
`533
`DrassteglOrgzset' FreresacssecactrfdcodecFasanocreeetctierereseensnrivpnerreeneonenmeresterrence
`538
`PHimting...cccccsssssssssssssen
`
`542
`
`Controlling Printouts......
`544
`;
`Fancy Printer Tricks........
`549
`Printer Troubleshooting sceoeceaaaee,
`550
`FROFAESisc aicpbsr nsanbalg isan beebak causa inonubg Ubra an NlgSaar La lan Raa aNanbapeeON DIOR
`551
`FeaUG schistscapeAaaaeaseageaoriellilaeS
`557
`SATIN TELE NEIIES is rccavaxatarnaknosaasoiectansannsaslptyat i iopiadid Liabestarenanis ccasecaasvinsenassiipbunicrssmvnarert
`
`
`
`
`
`
`
`
`
`
`azarae 1s|RarIVAN ictcaninapieatdostsucverainancciedaasindpaieariipeanaieeiaaiaane 559
`560
`External Gadgets.....
`
`Installing Cardsin Expansion slots.
`563
`
`
`Troubleshooting NewlyInstalled Gear,
`564
`
`566
`Driver Signing...
`ai
`
`The Device Manager.
`aurassanatnaabeaceurreserenarnacadeSiounaansSeenvransensipensElGieserrsngleleiienaierrrn
`567
`
`
`Chapter 19:RaEROpS:Tablets, andcapaipniURNENA 571
`Laptops...
`sien
`dienes cede absinubbaauoosNaaeion
`Tablet PCS...ibisiesSeasuwiatabiSaaccawvlacedacaciannnam
`Windows Mabile Devices.......ccsssssssessecscsonvsssseesessrsssesonseonsssesenseestecensevseenessesanansesestnensnsenseenseenesvenesse
`EVESUTA SPIRE.Goedersezrsannesovcnvencetanecrnvenssuncardtoessoannsdivmssnnnciinslacornfieanmesmumneionvannmeenelmuceeny
`MOURATEE FANSS ca socestanvanzvsusa coasts spsvarmcarsiisouven aousiunne nasal csuvt savas abaya nesaad Topsaaanuuspivany Ubaeeeownapahaas nar aimireme
`
`571
`575
`586
`587
`589
`
`Part Six: PC Health
`cssect 595
`Chapter 20: Maintenance andSooTSsii
`
`Disk Cleanup...
`
`Disk Defragmenter...=
`
`PP
`Hard Drive Checkups.
`EpisKe' WearaeappUTNEonmeeseninnssocciscncvrennnesnencsstczzveecbepmryycheneyioaadipeeyserenmnnedmnescenetenmspnanqeememperctee
`Task Scheduler .sesssssssssssscssssssssssesssessrscssssnsssssssvnesecaseesssnssnsnseussesseceeesessessesnntenssnunnsnessonegsscareenseensnssneesy
`POLE Spec TACKS sssssccscansiccsesasossnnssnsansianssscceasceensoocssccodpaaaancszanebessrecsbanaibaopanwabvstiasaagterbbsCbuecoMAuSulgpa
`NVAOWS UDSRE vii tscsasasinicaiairseasrsnassaasasesvanwusvie cacessannnsnwaeianlitacistos twseanevk abasic anncaiaaasiesabete
`
`595
`596
`599
`601
`606
`609
`614
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`TABLE OF CONTENTS
`
`
`
`

`

` Chapter 21: The Disk Chapter..............:0+«steadnifdeatanstetooeiebimpalentuiinh 2
`
`621
`DOVER DDISRS a scsacstssssssvesaazavaveccsssmionavasaanssessnaaavooces payne vn capsuesaiin ayqnanedi sniopmauenyaicetgorasatonaausanvseaiint
`629
`Compressing Files and Folders...
`
`633
`Encrypting Files and Folders.......
`papas
`BitLocker Drive ENcryptiOn .....-.scsssccccccssssenceca acesar 637
`
`
`
`
`
`Chapter 22: Backups and Troubleshooting ..........sssssssssssssreneesssersses 641
`AiROMIVARG BACKS ssscassnarsisssssnscntiesastsasvccasonestteveussarvauguessicG riesmmenpmaciciieatiessencaenanmansiettiny
`641
`Cartiphete: PE Ba CKUD: arvansessassscamencctiaceassscsicacecesacistonarasniseanescsiastsuswnitssenseaenisasanesesabassnasacees asec
`647
`SySterrd ROSHscsasaincrvpeatirnessassiaaunchussaveneSdsvsqnececsesaascodctyaisiitastesbianeesiaannenssenanTeimaion aaa as
`648
`ShadOW CODIS sci: aastains carina Criticaeen snouts
`654
`
`Safe Mode and the Startup M@NU...........:csscsessssssssssson
`656
`
`Problem Reports and SOIUtIONS........:.csssesesseesesesnees
`659
`
`Startup Repair (Windows Recovery EnvirOrment)....rssssssessccsssseerssnsseessnserecssseecssaesasseenne—OBL
`
`
`
`
`
`
`
`
`
`
`
`
`
`Part Seven: The Vista Network
`
`
`
`Chapter 23: Accounts (and Logging OM).......-ssss-sersessnerssssseneneeensenes 665
`Introducing User ACCOUMES......cssssscscsssssesssssssesssssucserssssessesssesessies
`wae,
`“665
`WindowsVista: The OS with TWo FAC€S....ssssssussssseeesesssssseeesnnussssssssneperaeenneensenaneegssennssyasnuevasestesses
`667
`
`
`HpacPACMAN ES opus 2escn spp csaseeanasauun enna UWNMaas guaranccobSSV apace vGiaosou anssucesa leaoees
`668
`
`Local Accounts On a Domain COMPpUter.....cssssucssssseseccssssececsessssssnpsatsesscnssssccesessessecccensensnyttsssuanssssy
`679
`Uingal Users ang GilBs ssinianaetitionindiAnemtiinadehineiinkiiemeiinmann WED
`
`FRG Stee SOUTsestcacnsaye
`renner:foparsoeescrseannnpssstonraseenseccennsdioesdensilieonmssnayeiveancssnenivansntostbrtlie
`686
`
`Logging OMe
`vue
`688
`
`
`
`PROTINES sccsussassisssiavassrrivcatannssnnnnssesiwobacawvizetsnsGassusnaaetaaaavdsisSSSs0iadabaanbeeenadaainbsccaaeeiniaaanaNNain 690
`
`
`NTFS Permissions: Protecting YOUr Stuff .......ssssssssssssesssssssccccsssssssivsssscssessssonecsessesesessesessanentvsnnuesses
`692
`
`
`
`
`
`
`
`
`
`
`
`
`
`Chapter 24: Setting Up a Workgroup Network.........ccscssesseeasereee 699
`BEERS BIT IN CRNWOMN EES scaetcpcsece morsetpeommin ire ceaoTTSE RwnT MMMOTEREENUNINNGecenrremnnres
`700
`Sharing an Intermet COMM@CUOM .....-secsessseecssssessesssesessessnsesesssssecssssesssesssustsssesassunsesssuesssusssesssssusoonn
`706
`The Network and Sharing Cemter .....csssssssssssssssssssssssssesssssssssssssessstssussssssssasesispusesssssavessensssesssssseyes
`708
`
`Chapter 26: Network Sharing and Collaboration.........::.0s--s:ssssssenee 729
`ByIVearASE: FILS asc asians iconv setansadbs disap ccnapubeaeey
`730
`PCEESSAmSEraseh: FMeeacecdsccancnsappevctcassszscesdesacaaadpcbaSvcacddocilansaaeeeoasstopvrentasobsantd68HNdby
`739
`Mapping Shares to: Drive Letters. secssssssscssecssseustsssssnsssesssssessonvsssecssssisistenpseyseuisisssedsissisesessmen
`24S
`Windows Meeting Space .eesascsessssessssscecsssossesssnesssssssessessoceesnsseesteessuusssssscvesseeanesssnnsenssesstsassunensevvseces
`745
`
`Chapter 25: Network Domaiss.............0ssssssesseesessnenesonde 717
`Fe EDU RS es canvas zancs coacabadasoc ht caeopsASSLeucins opted neck Ae buenos cade ica dada NowadalepeE Rens dine
`718
`
`
`
`JOMRREYS TACITGANIY ss nites succes ames tsexpuvesd is taatdccnionnieadsttdnngcdapeerpmveineeeetITSSwRooonoreaenniee 720
`
`Four WaysLife Is Different on a Domain...
`7
`Fe stone 722
`
`
`THE MISSING CREDITS
`
`
`
`

`

`Chapter 27: Vista PyRemote Control.........-ssssssscsnsssresnessersnsssnesnnese 751
`
`xxipeunarc ontario beatuaesaiomnesmenetaan sts
`rears
`Remote Access Basics...
`EDcaCORE sparnswvrtcxcevewszsstts ecencecgnomnmsvrengonsercre seasmeprcorsv7sbgpepngecteumtecnoenereregUeeente
`Virtual Privates Ne@tworkttagssssssssssisscaccssennaersvionvssesevmosseesiesusesiviiiasasoxsnisionoissisvaneenisssentasiconssatentenaatittes
`ReMiGke Desip sasciscciiiciionsscinrcnccrsswaniaucnnnnasinncesiiteneniiactiudncials wn nil aaiciasaeiinaamnNiE
`
`ea)
`753
`758
`760
`
`Part Eight: Appendixes
`Appendix A:Installing WindOWS Vista............ssssssscssssnseesnesnesnstenee 769
`Boertiae Yeo Busou eacsecsissvissvasnt shai encase neki anntiasieeSe ub poweicovees av iaassp mies ouaooies leave RcIo 769
`Upper ences STear UMSTEAD isn caccahiosennetsvtensonyserunecuventepteqnnespsstannsssigsopytenanicantpononenaribiensnessemseaptiiops 72
`eA ECORI NE ae ocdeveeyonts enpusovesssanvonnueeseracthoaoy Siacaeeyan arepeessnsieirndiuesenrcurnn teoeataieneteinsoars oesalees
`715
`Braisege: WincoWs Visteccsssssctoccsinsassccsssnssvsnivenciicccauccooaiaaspoisnntassansaatbsasanasssdamlnananaguannssnaaa
`775
`WACTe COMMER asscssuncsssscasansannassscestiscovoreasssiiscnsiialeaaasasassasnncoeseebihaioepaueMAeesSAsaSaSbnneaeaNaDSb nes
`780
`Activation...
`abs bagaNSHASK DNase bob areaBbc BuNG VelSetonasoctatamecaceceauccccisisaabbuee |
`Windows EasyTianstershitQSUBS214ARNGNUEdapMoanagoccRaIeS 783
`Appendix B: Fun with theaeReger=sahvieundlbadtetionnibalstantastedvid 787
`Meet Regedi....
`asap
`Sipitceiscence mMRETIRSERIN NNSA TED
`Regedit Exantiplesa seasvccOanaeceECCEVouRRcIpSTNNONUMNRRARRRRNRTA HAL
`Appendix C: Where'd It G0?.........:-ssssssssssssesecssesecsesesetsssencensensansonsavens 795
`
`Appendix D: The Master Keyboard Shortcut List .........scsscssssssesssssenns 799
`
`THE MISSING CREDITS
`
`
`
`
`
`
`
`
`
`
`
`

`

`The Missing Credits
`
`
`
`Aboutthe Author
`=
`David Pogueis the weekly tech columnist for the New York Times,
`an Emmy-winning correspondent for CBS News Sunday Morning,
`2006 winner of the Online News Association’s award for online
`commentary, and the creator of the Missing Manual series. He’s
`the author or co-authorof 40 books, including 17 in this series and
`six in the “For Dummies”line (including Macs, Magic, Opera, and
`Classical Music). In his other life, David is a former Broadway showconductor,a
`magician, and a pianist. News, photos,links to his columns and weekly videos await
`at www.davidpogue.com. He welcomes feedback about his books by email at david@
`pogueman,.com.,
`
`Joli Ballew (‘Tablet PC and Media Center chapters) is an author,
`Microsoft columnist, media expert, consultant, teacher, and tech-
`nical writer. She holds several certifications, including MCSE, A+,
`and MCDST,andhaswritten almost two dozen books on operating
`systems, image editing, home organization, and more. Her book
`Degunking Windows won the 2004 Independent Publisher Book
`Award for best computer book, and was a Parade Magazine “Best Bet.” Email: Joli@
`JoliBallew.com.
`
`C.A. Callahan (Control Panel chapter) is a ten-yearveteran ofthe IT
`industry, a Microsoft Certified Trainer, and ownerof her owntraining/
`technical writing company. She’s a frequent presenterat tech confer-
`ences and expos, including TechEd Boston, Windows Connections,
`and LinuxWorld/NetworkWorld Expo, and has co-authored several
`books,including the best selling technical reference Mastering Win-
`dows Server 2003, Her newbook, due in June 2007, is Mastering Windows SharePoint
`Services 3.0. Email: callahan@callahantech,com.
`
`
`
`
`
`a2
`
`Preston Gralla (security, backup and maintenance chapters) has
`used everyversion of Windowssince even before Windows3.1. He's
`the author of over 35 books, including Windows Vista in a Nutshell
`and the Windows Vista Pocket Reference. His articles have appeared
`in USA Today, The Los Angeles Times, The Dallas Morning News, PC
`Magazine, PC World, and many other newspapers and magazines.
`Email: preston@gralla.com,
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`THE MISSING CREDITS
`
`

`

`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`Brian Jepson (domain, remote-control, installation chapters; tech
`editor) isan O'Reilly editor, programmer, and co-author of Mac OS X
`Pantherfor Unix Geeks and Learning Unix for Mac OS X Panther. He’s
`also a volunteer system administrator and all-around geek for AS220,
`a non-profit arts center in Providence, Rhode Island. AS220 gives
`| Rhode Island artists uncensored and unjuriedgalleries, performance
`space, and publicationsfor their work. Brian sees to it that technology, especially free
`software, supports that mission. Email: bjepson@oreilly.com.
`
`Aboutthe Creative Team
`Teresa Noelle Roberts (copyeditor) is a freelance copy editor and proofreader,as
`well as a published fiction writer and poet. When she can tear herself away from
`the computer, she may be found gardening,belly dancing, or enjoying the beautiful
`beaches of New England.
`
`Onthis edition, she was joinedin her editorial duties by Missing Manuals editorial
`veteran John Cacciatore.
`
`Rose Cassano(coverillustration) has worked as an independent designerand illustra-
`tor for 20 years. Assignments have spanned everything fromthe non-profit sector to
`corporate clientele. She lives in beautiful southern Oregon, grateful for the miracles
`of moderntechnologythat make living and workingthere a reality. Email: cassano@
`highstream.net. Web: www.rosecassano.com.
`
`Lesa Snider King (production editor and graphics goddess) assists David Pogue on
`many projects. As Chief Evangelist for istockphoto.com and a veteran writer for
`international graphics publications, Lesa is an a mission to teach the world how to
`create beautiful graphics. You can see more of her work at TheGraphicReporter.com,
`andcatch her live at many conferences. Email: lesa@graphicreporter.com.,
`
`Shawn King (graphics assistance and beta reader) is the host of a popular Internet
`broadcastcalled Your Mac Life, and has been using computers since several years
`B.D. (Before DOS). Having grabbed a PC mouseandliterally followed every single
`step on everysingle page ofthis book to test for accuracy, he can safely say that he
`now knows more about WindowsVista than he ever hoped to know. Email: shawn@
`yourmaclife.com.
`
`Phil Simpson (design andlayout) works out ofhis office in Southbury, Connecticut,
`where he has had his graphic design business since 1982. He is experienced in many
`facets of graphic design, including corporate identity/branding, publication design,
`and corporate and medical communications. Email: pmsimpson@earthlink, net.
`
`Acknowledgments
`The Missing Manualseries is a joint venture between the dream teamintroduced on
`these pages and O’Reilly Media. I’m grateful to all of them, and also to a few people
`whodid massive favors for this book. They include Matt Parretta and Frank Kane,
`PR guys for Microsoft who devoted themselves to helping me find information;
`WindowsVista product manager Greg Sullivan, who tolerated being henpeckedwith
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`THE MISSING CREDITS
`
`

`

`
`
`
`
`
`
`my questions; HP and Motion for loaning me testing gear; and proofreaders Sohaila
`Abdulali, John Cacciatore, Genevieve d’Entremont, Jamie Peppard, Sada Preisch, and
`Ellen Seebacher.
`
`The book owesits greatest debt, though, to the husband-and-wife team of Shawn
`King and Lesa SniderKing.I'll never forget the 16-hourdaysofcheerful, professional
`work they put in during the final three weeks of this book’s creation,all in the name
`of making it the most polished, perfect book it couldbe. (J doubt they'll forget those
`days, either.)
`
`Thanks to David Rogelberg for believing in the idea, and aboveall, to Jennifer, Kelly,
`Tia, and Jeffrey, who make these books—and everything else—possible.
`
`—David Pogue
`
`The Missing ManualSeries
`Missing Manual books are superbly written guides to computer products that don't
`come with printed manuals (whichis just aboutall of them). Each book features a
`handcrafted index; cross-references to specific page numbers (not just “See Chapter
`14”); and RepKover, a detached-spinebinding thatlets the booklie perfectlyflat with-
`out the assistance of weights or cinder blocks. Recent and upcomingtitles include:
`
`* Windows XP Home Edition; The Missing Manual, 2nd Edition by David Pogue
`
`» Windows XP Pro: The Missing Manual, 2nd Edition by David Pogue, Craig Zacker,
`and L.J. Zacker
`
`* Access 2007: The Missing Manual by Matthew MacDonald
`
`» CSS: The Missing Manual by David Sawyer McFarland
`
`* Creating Web Stites: The Missing Manual by Matthew MacDonald
`
`+ Digital Photagraphy: The Missing Manual by Chris Grover, Barbara Brundage
`
`* Dreamweaver 8; The Missing Manual by David Sawyer McFarland
`
`* Dreamweaver MX 2004: The Missing Manual by David Sawyer McFarland
`
`+ eBay: The Missing Manual by Nancy Conner
`
`+ Excel 2007: The Missing Manual by Matthew MacDonald
`
`* FileMaker Pro 8; The Missing Manual by Geoff Coffey and Susan Prosser
`
`+ Flash 8: The Missing Manual by Emily Moore
`
`+ FrontPage 2003: The Missing Manualby Jessica Mantaro
`
`* Google: The Missing Manual, 2nd Edition by Sarah Milstein and Rael Dornfest
`
`- Home Networking: The Missing Manual by Scott Lowe
`
`+ The Internet; The Missing Manual by David Pogue and J.D. Biersdorfer
`
`« iPod; The Missing Manual, 5th Edition byJ.D. Biersdorfer
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`THE MISSING CREDITS
`
`

`

`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`* PCs: The Missing Manual by Andy Rathbone
`
`+ Photoshop Elements 5: The Missing Manual by Barbara Br

This document is available on Docket Alarm but you must sign up to view it.


Or .

Accessing this document will incur an additional charge of $.

After purchase, you can access this document again without charge.

Accept $ Charge
throbber

Still Working On It

This document is taking longer than usual to download. This can happen if we need to contact the court directly to obtain the document and their servers are running slowly.

Give it another minute or two to complete, and then try the refresh button.

throbber

A few More Minutes ... Still Working

It can take up to 5 minutes for us to download a document if the court servers are running slowly.

Thank you for your continued patience.

This document could not be displayed.

We could not find this document within its docket. Please go back to the docket page and check the link. If that does not work, go back to the docket and refresh it to pull the newest information.

Your account does not support viewing this document.

You need a Paid Account to view this document. Click here to change your account type.

Your account does not support viewing this document.

Set your membership status to view this document.

With a Docket Alarm membership, you'll get a whole lot more, including:

  • Up-to-date information for this case.
  • Email alerts whenever there is an update.
  • Full text search for other cases.
  • Get email alerts whenever a new case matches your search.

Become a Member

One Moment Please

The filing “” is large (MB) and is being downloaded.

Please refresh this page in a few minutes to see if the filing has been downloaded. The filing will also be emailed to you when the download completes.

Your document is on its way!

If you do not receive the document in five minutes, contact support at support@docketalarm.com.

Sealed Document

We are unable to display this document, it may be under a court ordered seal.

If you have proper credentials to access the file, you may proceed directly to the court's system using your government issued username and password.


Access Government Site

We are redirecting you
to a mobile optimized page.





Document Unreadable or Corrupt

Refresh this Document
Go to the Docket

We are unable to display this document.

Refresh this Document
Go to the Docket