US007060269B1
`
`(12) United States Patent
`US 7,060,269 B1
`(10) Patent No.:
`Baca et al.
`(45) Date of Patent:
`Jun. 13, 2006
`
`(54) AN 'l‘l—VEGF ANTIBODIES
`
`(75)
`
`Inventors: Manuel Baca, Foster City, CA (US);
`James A. Wells, Burlingame, CA (US);
`Leonard G. Presta, San Francisco, CA
`(US); Henry B. Lowman, El Granada,
`CA (US); Yvonne Man-yee Chen, San
`Mateo, CA (US)
`
`(73) Assignee: Genentech, Inc., South San Francisco,
`CA (US)
`
`( * ) Notice:
`
`Subject to any disclaimer, the term of this
`patent is extended or adjusted under 35
`U.S.C. 154(b) by 697 days.
`
`(21) Appl. No.: 09/723,752
`
`(22)
`
`Filed:
`
`Nov. 27, 2000
`
`Related U.S. Application Data
`
`(62) Division of application No. 08/908,469, filed on Aug.
`6, 1997, now Pat. No. 6,884,879.
`
`(51)
`
`Int. Cl.
`(2006.01)
`A61K 39/395
`(52) U.S. Cl.
`...............................
`424/133.1; 424/156.1;
`530/387.3; 530/388.85
`(58) Field of Classification Search ............. 424/130.1,
`424/133.1,135.1,141.1,155.1,156.1; 530/387.1,
`530/387.3, 388.1, 388.24, 388.8, 388.85
`See application file for complete search history.
`
`(56)
`
`References Cited
`
`U.S. PATENT DOCUMENTS
`
`4,816,567 A
`5,530,101 A
`5,558,864 A *
`5,580,723 A
`6,037,454 A
`2002/0032315 A1
`
`3/1989 Cabilly et 31.
`6/1996 Queen et al.
`9/1996 Bendig et al.
`12/1996 Wells et al.
`3/2000 Jardieu et al.
`3/2002 Baca et a1.
`
`FOREIGN PATENT DOCUMENTS
`
`EP
`GB
`GB
`W0
`W0
`W0
`W0
`W0
`W0
`W0
`
`0451216
`2188638
`2268744
`WO 91/09967
`WO 92/22653
`WO 94/04679
`WO 94/10202
`WO 96/30046
`WO 98/45332
`WO 98/45331
`
`*
`
`*
`
`1/1996
`10/1987
`12/1994
`7/1991
`12/1992
`3/ 1994
`5/1994
`10/1996
`10/1998
`10/1999
`
`Adamis et al., “Inhibition of Vascular Endothelial Growth
`Factor
`Prevents
`Retinal
`Ischemia-Associated
`Iris
`
`Neovascularization in a Nonhuman Primate” Arch Ophthal-
`mology 114(1):66-71 (1996).
`Aiello et al., “Vascular endothelial growth factor in ocular
`fluid of patients with diabetic retinopathy and other retinal
`disorders” New England J. ofMedicine 33l(22):l480-l487
`(1994).
`Alberts et al., “Molecular Biology of the Cell”, 3rd edition,
`Garland Publishing pp. 1154 (1994).
`Allen et al., “Specificity of the T cell Receptor: Two Dif-
`ferent Determinants are Generated by the Same Peptide and
`the 1Ak Molecule” .1. Immunol. 135(1):368-373 (Jul. 1985).
`Baca et al., “Antibody Humanization Using Monovalent
`Phage Display”
`Journal
`of Biological Chemistry
`272(16):10678-10684 (1997).
`Bass et al., “Hormone Phage: An Enrichment Method for
`Variant Proteins with Altered Binding Properties” Proteins:
`Structure, Function, and Genetics 8(4):309-314 (1990).
`Bendig, M. W., “Humanization of Rodent Monoclonal Anti-
`bodies” Methods: A Companion to Methods in Enzymolog/
`8:83-93 (1994).
`Berkman et al., “Expression of the vascular permeability
`factor/vascular endothelial growth factor gene in central
`nervous system neoplasms” J. Clin. Invest. 91(1):153-159
`(1993).
`Borgstrom et al., “Complete inhibition of angiogenesis and
`growth of microtumors by anti-vascular endothelial growth
`factor neutralizing antobody: novel concepts of angiostatic
`therapy from intravital videomicroscopy” Cancer Research
`56(17):4032-4039 (1996).
`Brown et al., “Expression of vascular permeability factor
`(vascular endothelial growth factor) and its receptors in
`adenocarcinomas of the gastrointestinal
`tract” Cancer
`Research 53(19):4727-4735 (1993).
`Brown et al., “Expression of vascular permeability factor
`(vascular endothelial growth factor) and its receptors in
`breast cancer” Human Pathology 26(1):86-91 (1995).
`Carter et al., “Humanization of an anti-pl85HER2 antibody
`for human cancer therapy” Proc. Natl. Acad. Sci. 89:4285-
`4289 (1992).
`Chang et al., “High-level secretion of human growth hor-
`mone by Escherichia coli” Gene 55:189-196 (1987).
`Chisholm, “High Efficiency Gene Transfer into Mammalian
`Cells” DNA Cloning 4, Mammalian Systems pp. 1-41
`(1995).
`
`(Continued)
`
`Primary ExamineriLarry R. Helms
`(74) Attorney, Agent, or Firm7Steven X. Cui; Genentech,
`Inc.
`
`OTHER PUBLICATIONS
`
`(57)
`
`ABSTRACT
`
`Lopez et al Invest. Opthal. and Visual Science 37:855,
`1996*
`Rudikoff et al., PNAS 79:1979, 1982*
`Yelton et al., J. of Immunol 155:1994-2004, 1995*
`Presta et al., “Humanization of an Anti-Vascular Endothelial
`Growth Factor Monoclonal Antibody for the Therapy of
`Solid Tumors and Other Disorders” Cancer Research
`
`Humanized and variant anti-VEGF antibodies and various
`uses therefor are disclosed. The anti-VEGF antibodies have
`
`strong binding affinities for VEGF; inhibit VEGF-induced
`proliferation of endothelial cells in vitro; and inhibit tumor
`growth in vivo.
`
`57(20):4593—4599 (Oct. 15, 1997).
`
`2 Claims, 16 Drawing Sheets
`
`Regeneron Exhibit 1023.001
`
`

`

`US 7,060,269 B1
`
`Page 2
`
`OTHER PUBLICATIONS
`
`Chothia et al., “Domain Association in Immunoglobulin
`Molecules. The Packing of Variable Domains” Journal of
`Molecular Biology 186:651-663 (1985).
`Clapp et al., “The 16-kilodalton N-terminal fragment of
`human prolactin is a potent inhibitor of angiogenesis” Endo-
`crinology 133(3):1292-1299 (1993).
`Cunningham et al., “Production of an Atrial Natriuretic
`Peptide Variant that is Specific for Type A Receptor” EMBO
`Journal 13(11):2508-2515 (1994).
`de Vries et al., “The fms-like tyrosine kinase, a receptor for
`vascular endothelial growth factor” Science 255:989-991
`(1992).
`“Vascular permeability factor/vascular
`al.,
`Dvorak et
`endothelial growth factor, microvascular hyperpermeability,
`and
`angiogenesis” American
`Journal of Pathology
`146(5):1029-1039 (1995).
`Eaton et al., “Construction and characterization of an active
`factor VIII variant
`lacking the central one-third of the
`molecule” Biochemistry 25:8343-8347 (1986).
`Eigenbrot et al., “X-Ray Structures of Fragments From
`Binding and Nonbinding Versions of a Humanized Anti-
`CDl8 Antibody: Structural Indications of the Key Role of
`VH Residues 59 to 65” Proteins: Structure, Function, and
`Genetics 18:49-62 (1994).
`Eigenbrot et al., “X-ray structures of the antigen-binding
`domains from three variants of humanized anti-p185HER2
`antibody 4D5 and comparison with molecular modeling” J.
`Mol. Biol. 229:969-995 (1993).
`Ferrara and Davis-Smyth,
`“The Biology of vascular
`endothelial growth factor” Endocrine Reviews 18(1):4-25
`(1997).
`Folkman and Shing, “Angiogenesis” Journal of Biological
`Chemistry 267:10931-10934 (1992).
`Foote et al., “Antibody Framework Residues Affecting the
`Conformation of the Hypervariable Loops” J Mol. Biol.
`224:487-499 (1992).
`Garner, A., “Vascular Diseases” Pathobiology of Ocular
`Disease, A Dynamic Approach, Garner, A., Klintworth GK
`Eds.. 2nd edition, NYzMarcel Dekker pp. 1625-1710 (1994).
`Garrard et al.,
`“Fab assembly and enrichment
`in a
`monovalent phage display system” Bio/technology 921373-
`1377 (1991).
`Good et al., “A tumor suppressor-dependent inhibitor of
`angiogenesis is immunologically and functionally indistin-
`guishable from a fragment of thrombospondin” Proc. Natl.
`Acad. Sci. USA 87(17):6624-6628 (1990).
`Gonnan et al., “Transient Production of Proteins Using an
`Adenovirus Transformed Cell Line” DNA Prot. Eng. Tech.
`2(1):3-10 (1990).
`Graham et al., “Characteristics of a Human Cell Line
`Transformed by DNA from Human Adenovirus Type 5” J.
`Gen. Virol. 36:59-74 (1977).
`Hawkins et al., “Selection of Phage Antibodies by Binding
`Affinity Mimicking Affinity Maturation” J. Mol. Biol.
`226:889-896 (1992).
`Horak et al., “Angiogenesis, assessed by platelet/endothelial
`cell adhesion molecule antibodies, as indicator of node
`metastases
`and
`survival
`in
`breast
`cancer” Lancet
`
`340(8828):1120-1124 (1992).
`Kabat et al. Sequences ofProteins ofImmunological Inter—
`est, U.S. Dept. of Health and Human Services, NIH, 5th
`edition vol. 12103-108, 324-331 (1991).
`
`Karlsson et al., “Kinetic analysis of monoclonal antibody-
`antigen interactions with a new biosensor based analytical
`system” J. Immun. Methods 145:229-240 (1991).
`Karlsson et al., “Kinetic and Concentration Analysis Using
`BIA Technology” Methods: A Comparison to Methods in
`Enzymology 6199-110 (1994).
`a Mouse
`Kettleborough
`et
`al.,
`“Humanization of
`Monoclonal Antibody by CDR-grafting: the Importance of
`Framework Residues on Loop Conformation” Protein Engi—
`neering 4(7):773-783 (1991).
`Kim et al., “Inhibition of Vascular Endothelial Growth
`Factor-Induced Angiogenesis Suppresses Tumour Growth in
`vivo” Nature 362:841-844 (1993).
`Kim et al., “The Vascular Endothelial Growth Factor Pro-
`teins: Identification of Biologically Relevant Regions by
`Neutralizing Monoclonal Antibodies” Growth Factors
`7(1):53-64 (1992).
`Klagsbrun and D’Amore, “Regulators of angiogenesis”Ann.
`Rev. Physiol. 53:217-239 (1991).
`Kunkel et al., “Efficient site-directed mutagenesis using
`uracil-containing DN ” Methods in Enzymology 2042125-
`139 (1991).
`Kunkel, T., “Rapid and Efficient Site-Specific Mutagenesis
`Without Phenotypic Selection” Proc. Natl. Acad. Sci.
`82:488-492 (1985).
`Leung et al., “Vascular Endothelial Growth Factor is a
`Secreted Angiogenic Mitogen” Science 246:1306-1309
`(1989).
`Lopez et al., “Transdilferentiated retinal pigment epithelial
`cells are immunoreactive for vascular endothelial growth
`factor in surgically excised age-related macular degenera-
`Invest.
`tion-related choroidal neovascular membranes”
`
`Ophthalmol. Vis. Sci. 37(5):855-868 (1996).
`Lowman et al., “Selecting High-Affinity Binding Proteins by
`Monovalent Phage Display” Biochemistry 30(45):10832-
`10838 (1991).
`Lucas et al., “High-level production of recombinant proteins
`in CHO cells using a dicistronic DHFR intron expression
`vector” Nucleic Acids Research 24(9):1774-1779 (1996).
`Macchiarini et al., “Relation of naovascularization to
`metastasis
`of
`non-small-cell
`lung
`cancer” Lancer
`340(8812):145-146 (1992).
`Mattern et al., “Association of vascular endothelial growth
`factor expression with intraturnoral rnicrovessel density and
`tumour cell proliferation in human epiderrnoid lung carci-
`noma” Brit. J. Cancer 73(7):931-934 (1996).
`Melnyk et al., “Vascular endothelial growth factor promotes
`tumor dissemination by a mechanism distinct from its effect
`on primary tumor growth” Cancer Research 56(4):921-924
`(1996).
`Novotny et al., “Structural invariants of antigen binding:
`comparison of immunoglobulin VL-VH and Vl-VL domain
`dimers” Proc. Natl. Acad. Sci. USA 82(14):4592-4596 (Jul.
`1985).
`O’Reilly et al., “Angiostatin: a novel angiogenesis inhibitor
`that mediates the suppression of metastases by a Lewis lung
`carcinoma” Cell 79(2):315-328 (1994).
`O’Reilly et al., “Endostatin: an endogenous inhibitor of
`angiogenesis and tumor growth” Cell 88(2):277-285 (1997).
`Padlan, E., “A Possible Procedure for Reducing the
`Immunogenicity of Antibody Variable Domains While Pre-
`serving Their Ligand-Binding Properties” Molecular Immu-
`nology 28(4/4):489-498 (1991).
`
`Regeneron Exhibit 1023.002
`
`

`

`US 7,060,269 B1
`Page 3
`
`Park et al., “Placenta growth factor, Potentiation of vascular
`endothelial growth factor bioactivity, in vitro and in vivo,
`and high affinity binding to Flt-1 but not to Flk-l/KDR”
`Journal of biological Chemistry 269(41):25646-25654
`(1994).
`Presta et al., “Humanization of an Antibody Directed
`Against IgE” J. Immunol. 151(5):2623-2632.
`Queen et al., “A humanized antibody that binds to the
`interleukin 2 receptor” Proc. Natl. Acad. Sci. USA
`86(24):10029-10033 (Dec. 1989).
`Roguska et al., “Humanization of murine monoclonal anti-
`bodies through variable domain resurfacing” Proc. Natl.
`Acad. Sci. USA 912969-973 (Feb. 1994).
`Rosok et al., “A Combinatorial Library Strategy for the
`Rapid Humanization of Anticarcinoma BR96 Fab” Journal
`of Biological Chemistry 271(37):22611-22618 (Sep. 13,
`1996).
`Sanger et al., “DNA Sequencing with Chain-terminating
`Inhibitors” Proc. Natl. Acad. Sci. USA 74(12):5463-5467
`(Dec. 1977).
`Shalaby et al., “Development of Humanized Bispecific
`Antibodies Reactive with Cytotoxic Lymphocytes and
`Tumor Cells Overexpressing the HER2 Protooncogene”
`Journal of Experimental Medicine 175:217-225 (Jan. 1,
`1992).
`Studnicka et al., “Human-engineered monoclonal antibodies
`retain full specific binding activity by preserving non-CDR
`
`Protein
`
`Eng.
`
`residues”
`
`complementarity-modulating
`7(6):805-814 (1994).
`Tempest et al., “Reshaping a Human Monoclonal Antibody
`to Inhibit Human Respiratory Syncytial Virus Infection In
`Vitro” Bio/Technology 91266-271 (Mar. 1991).
`Vieira et al., “Production of Single-stranded Plasmid DNA”
`Methods in Enzymology 15113-11 (1987).
`Warren et al., “Regulation by vascular endothelial growth
`factor of human colon cancer tumorigenesis in a mouse
`model of experimental
`liver metastasis” J. Clin. Invest.
`95(4):1789-1797 (1995).
`and
`angiogenesis
`“Tumor
`Weidner
`et
`al.,
`metastasis%orrelation in invasive breast carcinoma” New
`
`England J. ofMedicine 324(1);1-8 (1991).
`Werther et al., “Humanization of anAnti-Lymphocyte Func-
`tion-Associated Antigen (LFA)-1 Monoclonal Antibody and
`Reengineering of the Humanized Antibody for Binding to
`Rhesus LPA-1” J. ofImmunology 157:4986-4995 (1996).
`Winter et al., “Making antibodies by phage display technol-
`ogy” Annual Review ofImmunology 12:433-455 (1994).
`Yang et al., “CDR walking mutagenesis for the affinity
`maturation of a potent human anti-HIV—l antibody into the
`picomolar range” Journal ofmolecular Biology 254(3):392-
`403 (Dec. 1, 1995).
`
`* cited by examiner
`
`Regeneron Exhibit 1023.003
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 1 of 16
`
`US 7,060,269 B1
`
`Variable Heavy
`
`A4.6.l
`
`EIQLVQSGPELKQPGETVRISCKASQXIEIEXQMNWVKQAPGKGLKWMG
`*
`f
`** f
`**t
`i
`i
`*
`* *
`
`F(ab)-12 EVQLVESGGGLVQPGGSLRLSCAASQXIEIHXQMHWVRQAPGKGLEWVG
`*
`it * *
`*
`
`humIII
`
`EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS
`1
`10
`20
`30
`4O
`
`A4.6.1
`
`EIEIXIGEEIXAADEKBRFTFSLETSASTAYLQISNLKNDDTATYFCAK
`*
`t
`t** t**
`* *
`
`F(ab) - 12
`
`G P
`W
`k **t* ***
`
`RRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAK
`D
`*** t
`t t *
`* t
`*
`
`“3‘ IA
`
`humIII
`
`VISGDGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
`50
`a
`60
`70
`80
`abc
`90
`
`A4 . 6.1
`
`XPHXXGSSHflEDVWGAGTTVTVSS (sea \0 mom)
`*
`*
`
`F(ab)-12 YPHXXGSSHflEQVWGQGTLVTVSS (SEQ \b MOP?)
`*
`*
`G ---------- FDYWGQGTLVTVSS (SEC; H) No‘ ‘5
`11o
`
`humIII
`
`Variable Light
`
`A4 . 6 .1
`
`DIQMTQTTSSLSASLGDRVIISCSASQDLSNXLlNWYQQKPDGTVKVLIY
`**
`t
`i
`*
`****
`
`F (ab) - 12 DIQMTQSPSSLSASVGDRVTITCSASQDISEZLEWYQQKPGKAPKVLIY
`*
`f
`t
`*
`
`humKI
`
`DIQMTQSPSSLSASVGDRVTITCRASQSISNYLAWYQQKPGKAPKLLIY
`1
`10
`20
`30
`40
`
`A4 . 6 . 1
`
`E'L‘SSLHSGVPSRFSGSGSGTDYSLTISNLEPEDIATYYCQQXWF
`if
`t t
`t
`
`E‘ ( ab) - 12 ElSSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCWF
`**
`*
`*t*
`
`humKI
`
`AASSLESGVPSRFSGSGSG‘I‘DFTLTISSLQPEDFATYYCQQYNSLPWTF
`so
`60
`7o
`80
`90
`
`Fig. 18
`
`A4 . 6.1
`
`GGGTKLEIKR (SEQ \‘D No: to)
`t
`*
`
`F(ab)-l2 GQGTKVEIKR (S E8. \D N013)
`
`humKI
`
`GQGTKVEIKR (SE6) \D Non lb)
`100
`
`Regeneron Exhibit 1023.004
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 2 of 16
`
`US 7,060,269 B1
`
`
`
`Regeneron Exhibit 1023.005
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 3 of 16
`
`US 7,060,269 B1
`
`n.om>on.0w>n<22E+n_0m>:0:uGm>n<zse+u.0w>IO:
`
`
`5:6302I0000:
`
`oooomw
`
`ooooow
`
`IIGM 19d 3“35) l9!l9Lfl09U3
`
`
`
`:EBScofiwzcmocoo93
`
`88*8909orFto
`
`n.wam
`
`Regeneron Exhibit 1023.006
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 4 of 16
`
`US 7,060,269 B1
`
`Tumor Weight (gm)
`
`Control MAb (5)
`
`rhuMAb VEGF (5)
`
`muMAb VEGF (0.5)
`
`muMAb VEGF (5)
`
`rhuMAb VEGF (0.5)
`
`Fig. 4
`
`Regeneron Exhibit 1023.007
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 5 of 16
`
`US 7,060,269 B1
`
`Fig. 5A
`
`VL domain
`
`40
`30
`20
`10
`DIQMTQTTSSLSASLGDRVIISCSASQDISNYLNWYQQKP
`it
`t
`t *
`
`DIQHTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKP
`
`DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQOKP
`
`80
`70
`60
`50
`DGTVKVLIYETSSLHSGVPSRFSGSGSGTDYSLTISNLEP
`it
`«*a* t
`it
`
`GKAPKLLIYFTSSLHSGVPSRFSGSGSGTDFTLTISSLQP
`
`GKAPKLLIYFTSSLHSGVPSRFSGSGSGTDYTLTISSLQP
`
`90
`
`100
`
`EDIATYYCQQYSTVPWTE‘GGGTKLEIK (QEG \D No: uh
`‘-
`k
`l-
`
`EDPATYYCQQYSTVPWTFGQGTKVEIK (EEG \0 NO \33
`
`A4.6.1
`
`hu2.0
`
`hu2.10
`
`A4.6.1
`
`hu2.0
`
`hu2.10
`
`A4.6.1
`
`hu2.0
`
`hu2.10
`
`EDFATYYCQQY STVPWTFGQGTKVEIK C SEQ \ o N O‘- 53
`
`-- VH domain
`
`A4.6.l
`
`hu2.0
`
`hu2.10
`
`4 o
`3 0
`20
`10
`EIQLVQSGPELKQPGETVRISCKASGYTFTNYGMNWVKQA
`*
`l'
`1' i
`1'
`i’ i * t
`*
`*
`
`EVQLVESGGGLVQPGGSLRLSbAASGYTFTNYGHNWVRQA
`
`EVQLVESGGGLVQPGGSLRLSCAASGTTFTNYGMNWIRQA
`
`A4,6.1
`
`80
`70
`60
`50 a
`PGKGLKWMGWINTYTGEPTYAADFKRRFTFSLETSASTAYL
`**
`*tttk‘rt
`
`Fig. SB
`
`hu2.0
`
`PGKGLEWVGWINTYTGEPTYAADFKRRFTISRDNSKNTLYL
`
`hu2.10
`
`PGKGLEWVGWINTYTGEPTYAADFKRRFTISLDTSASTVYL
`
`A4.6.1
`
`hu2.0
`
`abc
`
`90
`
`100abcdef
`
`110
`
`QISNLKNDDTATYFCAKYPHYYGSSHWYFDVWGAGTTVTVSS (SECQ “>P¢014\
`*t* *l-*
`I' i
`i
`t
`t
`
`QMNSLRAEDTAVYYCARYPHYYGSSHWYE‘DVWGQGTLVTVSS (SECS) n) M07 “9
`
`hu2.10
`
`QMNSLRAEDTAVYYCAKYPHYYGSSHWYE‘DVWGQGTLVTVSS ($931 (D NO‘V‘I’)
`
`Regeneron Exhibit 1023.008
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 6 of 16
`
`US 7,060,269 B1
`
`
`
`Regeneron Exhibit 1023.009
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 7 of 16
`
`US 7,060,269 B1
`
`
`
`Transform E. coli
`
`+ M13KO7 helper phage
`
`
`
`Fig. 1
`
`Regeneron Exhibit 1023.010
`
`

`

`U.S. Patent
`
`Jun.13,2006
`
`Sheet8 0f16
`
`US 7,060,269 B1
`
`0048800408
`0400484480
`8004440088
`4448440440
`8040044804
`0488888048
`0808084888
`0088480044
`4084800404
`4088044880
`
`0084400804
`0800848840
`4008880044
`8884880880
`4080088408
`0844444084
`0404048444
`0044840088
`8048400808
`8044088440
`
`H
`
`0484004004
`0800884004
`0008400000
`4448004004
`8080000000
`0404800408
`4088408800
`0040440040
`8444400000
`8484400088
`
`0848008008
`0400448008
`0004800000
`8884008008
`4040000000
`0808400804
`8044804400
`0080880080
`4888800000
`4848800044
`
`8040400000
`0408088044
`4840808004
`0440888808
`4488044444
`8040800800
`8400440884
`8804404448
`0048840000
`0800800400
`
`4080800000
`0804044088
`8480404008
`0880444404
`8844088888
`4080400400
`4800880448
`4408808884
`0084480000
`0400400800
`
`HOH
`
`How
`
`8808888804
`8444480400
`8044008084
`0400480000
`0008400040
`0800448808
`4088404448
`4048844444
`4844444044
`4000408484
`
`4404444408
`4888840800
`4088004048
`0800840000
`0004800080
`0400884404
`8044808884
`8084488888
`8488888088
`8000804848
`
`man
`
`am4maqmaqua
`
`2
`
`8080000080
`8000800400
`
`
`
`
`
`monasuoaMadmanHHumcanon
`
`
`
`
`
`000804000408804008484080004800
`
`0044404800
`8848088888
`8008808480
`8400880880
`8884000848
`
`How
`
`mu-
`
`4040000040
`4000400800
`0004080008
`0440800484
`8040008400
`0088808400
`4484044444
`4004404840
`4800440440
`4448000484
`
`HUMOH4H0m§
`oawumuomou
`
`
`
`
`
`adageugmaaaamom
`
`
`
`
`
`muomaaonz8swqaaomaumm4ma4ua8ua
`
`4am4un8aa4
`UHHmewan
`a>wgmuuxuo
`muH4squon
`unmuH4vHH
`
`mauzwnsmtha
`oumaa4m>aa
`Huoummaaad
`undou88mu8
`:m4nmaum8a
`m4uomoaumm
`4GH08006H4
`Homm80848o
`Haun8ao>mu
`44m4aaoau>
`
`ma
`
`8040840888
`0004008888
`0080088808
`0880484004
`0888444840
`8800844848
`0080408800
`0080040080
`4800804000
`8480000040
`
`4080480444
`0008004444
`0040044404
`u<408¢8uu8
`0444888480
`4400488484
`0040804400
`0040080040
`8400408000
`4840000080
`
`non
`
`8080008004
`0408008048
`ouauaoaoao
`8448000800
`ococaoouoa
`8004040440
`0040440004
`oauo4u¢u8u
`0404040040
`0804408444
`
`=a0oumaa0=w
`Akwmuwmmdu
`un8nuqun8u
`88mm4un884
`ouwmxauumm
`adouwmwnmm
`u4uwmoumau
`>8Huuwmmflm
`50AHQMHOmH
`:8oamu88
`
`av
`
`4040004008
`0804004084
`ou<o8oao¢o
`4884000400
`uaoaaouuua
`4uoao8088u
`0080880008
`u<uoao8u<o
`0808080080
`0408804888
`
`How
`
`4048008004
`uoo<o¢U8au
`U888048uao
`0400880084
`uuuaoaou<<
`4008004000
`0400080084
`8408088040
`4084484408.
`8uoo¢4u808
`
`H0m0HmflH<d
`H4Hu>ug8mu
`«mmquHaao
`Ha>m808488
`Huaaomauw:
`8828088088
`H4>H£HHNWH
`88:80aa0m8
`ouaauaauga
`aa¢anmmn4
`
`No
`
`8084004008
`oouau8o<<u
`o<<4o84u<u
`0800440048
`uuu<u<uuaa
`8004008000
`0800040048
`4804044080
`8048848804
`«000880404
`
`Heb
`
`4080840888
`0000808080
`0048404408
`8488040040
`0040404404
`0440040880
`0404888044
`0800804804
`0480000004
`4048044040
`
`mu8aHOH¢>m8q
`aa4aaomu¢o
`nmua8onmam
`4=m4suqsoa
`m>04m>am>8
`mmua<unaaa
`0uwwm>q=oq
`aa0=a0mm4u
`MWORQOHWQS
`mwdeana>
`
`man
`
`8040480444
`0000404040
`0084808804
`4844080080
`0080808808
`uaauuauaco
`0808444088
`0400408408
`0840000008
`8084088080
`
`doc
`
`awaun8duqun
`8Hmmuom=oq
`num888ug8u
`ommm4maquo
`mmmcauoaao
`848Hu>num=
`H0na0uwmam
`48H0H00=H0
`aqua4cm4m
`m4fiu>m8a
`
`4000804000
`8008008040
`0080840080
`0808008800
`8080080080
`8080404080
`8008000408
`8400004880
`0400000884
`8004008800
`
`8000408000
`4004004080
`0040480040
`0404004400
`ao¢ooaoo4u
`4040808040
`4004000804
`4800008440
`0800000448
`4008004400
`
`Hom
`
`ova
`
`auauauuuou
`0808804400
`80888eau¢u
`0000040080
`4000008048
`0008040880
`0040000840
`4088808088
`8080084080
`8008880080
`
`mausdumaom
`H<flm40£m80
`mmaaun8au>
`OHEHQMwaS
`waaaocaumd
`=848HM>SH0
`m80c44u>8a
`a>m>amamm>
`asa0uh8mm4
`na4mhauom
`
`mad
`
`8u8u<u¢oou
`0404408800
`¢u¢¢<u<o8w
`0000080040
`8000004084
`0004080440
`0080000480
`8044404044
`4040048040
`4004440040
`
`Heed
`
`4a.wfim
`
`Regeneron Exhi
`
`it 1023.011
`
`

`

`U.S. Patent
`
`Jun.13,2006
`
`Sheet9 0f16
`
`US 7,060,269 B1
`
`484088404084
`08000:mm-
`
`0084844044
`4440848888
`4080040880
`0404808480
`00H_n808
`8048044000
`
`0048488088
`8880484444
`8040080440
`0808404840
`0088888400
`4084088000
`
`
`
`
`
`400450000080084000400000048080
`
`
`
`
`
`840840000040048000800000084040
`
`
`
`
`
`
`
`00:0:000844080880048804
`
`
`
`
`
`480408>404c8004
`
`880840o8444
`0848504880
`880880800:
`80Hu>5wqca
`0Hfl>sd0484
`8880844048
`:80H40HH80
`muzmau>04m
`004800084:
`UASOQNSQ
`
`8484004448
`0080000488
`8080888800
`
`4848008884
`0040000844
`4040444400
`
`8880880808
`8008480004
`mH4>0nm08m
`
`84044>088=
`8000484008
`4840080484
`4400840480
`8840400288
`0888404848
`0448488888
`HUkwmfiH4mH
`4080800004
`084504800
`
`88044084008
`880>mm4040
`8880880848
`0080088088
`888808=o84
`8880840840
`8088888880
`>4H4H£8mm4
`0800840840
`04800004
`
`8800044844
`4484884084
`0800848800
`0808008000
`8448450408
`mmcmda>kwm
`0848800848
`488000H480
`080044>848
`Hu>smau£8
`
`08484840480
`0080084084
`=04aa>4m4m
`8008888884
`8440848880
`Swdkflmkmmh
`0008mflu>84
`8H4>H4>8wm
`80m=UQ80MH
`88004880
`
`4044840020
`80:8088840
`4040004880
`8008808008
`8084088080
`00:450a08w
`8480840040
`8080008408
`408084>084
`mhqmm4aa>
`
`:84600mam08000
`
`
`4844004088new
`
`4800800800
`0488408048
`0008080884
`
`0008040004
`0880400048
`8800044884
`
`
`
`
`
`088044400044480004080804048000
`
`
`
`
`
`040004004444804004084004004884
`
`88000488084
`>0HUMH4U¢E
`4808004048
`0084044404
`0004880848
`0848804048
`804m44H4=w
`488080080>
`0048800480
`40840004
`
`
`
`
`
`000808440880008440800080008800
`
`
`
`
`
`000404880440004880400040004400
`
`4888484408
`0008884484
`4084488800
`4088448408
`
`8444848804
`0004448848
`8048844400
`8044884804
`
`44.088
`
`
`
`
`
`
`
`08408008080>8wmca00805048000800048880800
`
`84mnm=m4cm
`4004504088
`800004404
`
`0000040004
`0080080000
`8000008080
`4008008004
`0880040800
`0480000444
`0480088480
`8888880088
`0848084008
`8088088840
`
`0000080008
`0040040000
`4000004040
`8004004008
`0440080400
`0840000888
`0840044840
`4444440044
`0484048004
`4044044480
`
`4008800084
`4008000004
`4800000000
`0408000840
`0804408480
`0848044004
`0880048480
`0080880040
`0808008088
`8000804080
`
`8004400048
`8004000008
`8400000000
`0804000480
`0408804840
`0484088008
`0440084840
`0040440080
`0404004044
`4000408040
`
`002040004888
`Hu>H£8=m48
`0080084800
`40H48000HH
`8480440840
`8408dunmmm
`4084084888
`848oum=808
`8084888884
`8cm4088m88
`
`4040080048
`8804040440
`0400800404
`0400808484
`8048888008
`0044408884
`0000800848
`0040004408
`0000484800
`4044884008
`
`8080040084
`4408080880
`0800400808
`0800404848
`4084444004
`0088804448
`0000400484
`0080008804
`0000848400
`8088448004
`
`0044080000
`8080040088
`8480080400
`0400400084
`8848040000
`0480444008
`0804884808
`0000804040
`0408000000
`8000404408
`
`0088040000
`4040080044
`4840040800
`0800800048
`4484080000
`0840888004
`0408448404
`0000408080
`0804000000
`4000808804
`
`0000800000
`0040400000
`0808004004
`0440080080
`0040008000
`0088080008
`4000000440
`0400800000
`8008080004
`0800800044
`
`0000400000
`0080800000
`,0404008008
`0880040040
`0080004000
`0044040004
`8000000880
`0800400000
`4004040008
`0400400088
`
`8008040480
`0808000000
`8800404008
`0000004004
`0800000004
`0804400800
`8080004080
`0004400000
`8804804004
`4080080008
`
`HONH
`
`8H-
`
`Hand
`
`EH
`
`8008
`
`cm
`
`09
`
`Hand
`
`H008
`
`88H
`
`8088
`
`4004080840
`0404000000
`4400808004
`0000008008
`0400000008
`0408800400
`4040008040
`0008800000
`4408408008
`8040040004
`
`800800080504
`80>48408mw
`4&848084H4
`>880800848
`5004848808
`0040448880
`0H4>H£8Hu>
`0845800880
`40888mm4m8
`480>004080
`
`and
`
`4400404400
`4000044040
`8440800440
`0808404800
`4040004000
`0880040040
`0800008000
`4080080004
`0040800080
`4808040040
`
`8800808800
`8000088080
`4880400880
`0404808400
`8080008000
`0440080080
`0400004000
`8040040008
`0080400040
`8404080080
`
`0444000840
`4444084884
`0888840800
`0088008080
`0080000080
`4048080040
`8044440408
`0880844400
`0040880444
`0440400800
`
`0888000480
`8888048448
`0444480400
`0044004040
`0040000040
`8084040080
`4088880804
`0440488800
`0080440888
`0880800400
`
`H008
`
`«ad
`
`8008
`
`hHN
`
`8400400400
`0844804084
`0004040448
`0440888000
`8884000804
`0408084000
`0088880480
`0004888800
`0804840000
`0088488400
`
`048084444880
`8884048484
`H484>8wmmm
`4004084840
`0840840048
`0048000408
`4404040004
`084=m4=408
`4800204488
`0084004084
`
`emu
`
`0044440840
`0008444400
`0408480000
`0044844800
`
`Hoon
`
`0480400884
`
`0840800448
`
`«088
`
`«00
`
`man
`
`0004080008
`0440800084
`4400088448
`0800080088
`8840800804
`8008008448
`0084480088
`0000008880
`0408008840
`8880084008
`
`0048840044
`0000004440
`0804004480
`4440048004
`
`HOHN
`
`«an
`
`HONN
`
`88m
`
`Regeneron Exhi
`
`it 1023.012
`
`
`

`

`U.S. Patent
`
`Jun. 13, 2006
`
`Sheet 10 of 16
`
`US 7,060,269 B1
`
`am4dd4mzmk£8
`80m0£mdn>k
`aauozugmu:
`and4aa>u88
`Dwdflflflwfimd
`
`4800888004
`8400444008
`8088884808
`4044448404
`4808488800
`8<048¢<¢ou
`¢ouoaau8<a
`auuo<<gzax
`8nxxzczz<o
`«888808886
`
`0040084008
`0080048004
`0000040004
`0000080008
`4000000040
`8000000080
`0080808800
`0040404400
`«acauououo
`8¢8<ouuuoo
`
`
`
`ouaeaoeuau,usuu988¢88o<<¢8¢¢¢4u
`
`
`
`uu<<uo<uxu,umuuo<<8¢<0888<88880
`
`
`
`
`
`H<mnman>aaumu<mna=uaam<oaummqm
`
`
`
`
`
`ouc<auuu8888088040008<U8<48808
`
`
`
`
`
`000840004444044080004804884404
`
`8040448044
`8404444880
`
`m4maomm4vfl
`Hammonmad0
`
`own
`
`4080884088
`4808888440
`
`Hon"
`
`0800884884
`0004084808
`
`0400448448
`0008048404
`
`Hovn
`
`0084408080
`4404000088
`0884408440
`0040088440
`4400804004
`0884000448
`0008004000
`0000004400
`8440800400
`8004000000
`
`0048804040
`8808000044
`0448804880
`0080044880
`8800408008
`0448000884
`0004008000
`0000008800
`4880400800
`4008000000
`
`0000800004
`0000800800
`0880004000
`0080840000
`0000400000
`4004008084
`0000080000
`8400848404
`4040008800
`0440044400
`
`0000400008
`0000400400
`0440008000
`0040480000
`0000800000
`8008004048
`0000040000
`4800484808
`8080004400
`0880088800
`
`8040004408
`0044000400
`0048400040
`8440844040
`0488008048
`8000880000
`0008000480
`0000040040
`8800808008
`0080084084
`
`4080008804
`0088000800
`0084800080
`4880488080
`0844004084
`4000440000
`0004000840
`0000080080
`4400404004
`0040048048
`
`8400400800
`0000408044
`0000044400
`8080444800
`8880800088
`8000880800
`8440840440
`4400408004
`0008080044
`4400800800
`
`4800800400
`0000804088
`0000088800
`4040888400
`4440400044
`4000440400
`4880480880
`8800804008
`0004040088
`8800400400
`
`0808888840
`8040800040
`8840008000
`0440044884
`8080840480
`0404400808
`0004800080
`0800840040
`0084008084
`0000880848
`
`0404444480
`4080400080
`4480004000
`0880088448
`4040480840
`0808800404
`0008400040
`0400480080
`0048004048
`0000440484
`
`0808080084
`0040800848
`0000448040
`8408408808
`4000000448
`0400880044
`0408000488
`8088040000
`0484008400
`0000008008
`
`0404040048
`0080400484
`0000884080
`4804804404
`8000000884
`0800440088
`0804000844
`4044080000
`0848004800
`0000004004
`
`8880000000
`8404488000
`0004444440
`0404440040
`8044084000
`4000404880
`0000884440
`4044084000
`0048840848
`0008408880
`
`4440000000
`4808844000
`0008888880
`0808880080
`4088048000
`8000808440
`0000448880
`8088048000
`0084480484
`0004804440
`
`0040840800
`0400400408
`8000844080
`8084040400
`0404408400
`0004008004
`0044080444
`0400808800
`0448840404
`0004404084
`
`0080480400
`0800800804
`4000488040
`4048080800
`0808804800
`0008004008
`0088040888
`0800404400
`0884480808
`0008808048
`
`0844400000
`4844004488
`8888408004
`0844488088
`8884448800
`0088444488
`0888848448
`8004448088
`4440000840
`0400004888
`
`0488800000
`8488008844
`4444804008
`0488844044
`4448884400
`0044888844
`0444484884
`4008884044
`8880000480
`0800008444
`
`0044008040
`0800440444
`8848040080
`4044044008
`8804008808
`8080408800
`0484040004
`0484404444
`0844484880
`0084444000
`
`0088004080
`0400880888
`4484080040
`8088088004
`4408004404
`4040804400
`0848080008
`0848808888
`0488848440
`0048888000
`
`0084448040
`0444800008
`0040080000
`8888880440
`8448000408
`4004408004
`8040000084
`8000040848
`0800044444
`0000044408
`
`0048884080
`0888400004
`0080040000
`4444440880
`4884000804
`8008804008
`4080000048
`4000080484
`0400088888
`0000088804
`
`0000048000
`0000040044
`4000444044
`0004400444
`0400008004
`4000000044
`4000004088
`0040488840
`0000004000
`4448000440
`
`0000084000
`0000080088
`8000888088
`0008800888
`0800004008
`8000000088
`8000008044
`0080844480
`0000008000
`8884000880
`
`0800088800
`0000800080
`0840000800
`0000040480
`0000008448
`8000000000
`0404004004
`4800000800
`0408000048
`0804400080
`
`0400044400
`0000400040
`0480000400
`0000080840
`0000004884
`4000000000
`0808008008
`8400000400
`0804000084
`0498800040
`
`0040800000
`0040800000
`4404040040.
`0000084000
`0448080808
`8004040800
`0404000008
`0040084040
`4080800444
`4080004084
`
`0080400000
`0080400000
`8808080080
`0000048000
`0884040404
`4008080400
`0808000004
`0080048080
`8040400888
`8040008048
`
`on.048
`
`
`
`nos...020.,Gwfl62%
`
`
`:«uuoumnu6:0
`
`saumhanm¢m
`H45040HH
`
`van
`
`«own
`
`flown
`
`Hahn
`
`Hcmm
`
`«can
`
`doom
`
`HOHM
`
`down
`
`aonn
`
`Hovm
`
`down
`
`down
`
`Hofim
`
`down
`
`Regeneron Exhi
`
`it 1023.013
`
`

`

`U.S. Patent
`
`Jun.13,2006
`
`Sheetll 0f16
`
`US 7,060,269 B1
`
`4080480884
`0400404084
`0000084804
`4880008048
`4808040000
`4840004800
`zuuv¢uoo<o
`.8400040000
`.0000808000
`0008808000
`
`8040840448
`0800808048
`0000048408
`8440004084
`8404080000
`8480008400
`aocuaoouau
`4800080000
`0000404000
`0004404000
`
`0800008000
`8040804080
`0080088000
`0880800000
`4084000048
`4444040044
`8000840404
`0000484440
`8080000848
`40U4008040
`
`0400004000
`4080408040
`0040044000
`0440400000
`8048000084
`8888080088
`4000480808
`0000848880
`4040000484
`8008004080
`
`4444004080
`8404404440
`0400044840
`0004084404
`0400848800
`0484480000
`0444080408
`0040848000
`0400000080
`0008800800
`
`8888008040
`4808808880
`0800088480
`0008048808
`0800484400
`0848840000
`0888040804
`0080484000
`0800000040
`0004400400
`
`0804408000
`4008444440
`4084004004
`0800000000
`0800048400
`8888800008
`0088000000
`0444448000
`amou¢uuou<
`4440040000
`
`0408804000
`8004888880
`8048008008
`0400000000
`0400084800
`4444400004
`0044000000
`0888884000
`aauuauouua
`8880080000
`
`4840000488
`0000080004
`0008808008
`0800008008
`0008004400
`8000008880
`0004004840
`4448480400
`4040000444
`0000800404
`
`8480000844
`0000040008
`0004404004
`0400004004
`0004008800
`4000004440
`0008008480
`8884840800
`8080000888
`0000400808
`
`8080000800
`4400800088
`0080048080
`0088040808
`4800480800
`0408004840
`8088800000
`8000440000
`8800080888
`0000080800
`
`4040000400
`8800400044
`0040084040
`0044080404
`8400840400
`0804008480
`4044400000
`4000880000
`4400040444
`0000040400
`
`0400400080
`4000084880
`4004040448
`0000044008
`0408808008
`4804480000
`8488000008
`0000400000
`4088000000
`0440040080
`
`0800800040
`8000048440
`8008080884
`0000088004
`0804404004
`8408840000
`4844000004
`0000800000
`8044000000
`0880080040
`
`0088848040
`4004404804
`0480000480
`4480000800
`8044088088
`0404048008
`0000048084
`8004000404
`0048840040
`4480080400
`
`0044484080
`8008808408
`0840000840
`8840000400
`4088044044
`0808084004
`0000084048
`4008000808
`0084480080
`8840040800
`
`0088808888
`8880080000
`4800800004
`0044404440
`0000840880
`8004800880
`4044444000
`8800488040
`0044080080
`8000080848
`
`0044404444
`4440040000
`8400400008
`0088808880
`0000480440
`4008400440
`8088888000
`4400844080
`0088040040
`4000040484
`
`4000448800
`4080444400
`4400804080
`0040808000
`0048088880
`8408880084
`0440440808
`4004444444
`0400000488
`4040040044
`
`8000884400
`8040888800
`8800408040
`0080404000
`0084044440
`4804440048
`0880880404
`8008888888
`0800000844
`8080080088
`
`0800880444
`8040848484
`8044480844
`0844488880
`4408444448
`8444888800
`8404800408
`8084004444
`4084884040
`8408008888
`
`0400440888
`4080484848
`4088840488
`0488844440
`8804888884
`4888444400
`4808400804
`4048008888
`8048448080
`4804004444
`
`0048044840
`4808008000
`0080408000
`8804840084
`0880088848
`0808084000
`4080848004
`0004080408
`4488008440
`0488040408
`
`0084088480
`8404004000
`0040804000
`4408480048
`0440044484
`0404048000
`8040484008
`0008040804
`8844004880
`0844080804
`
`Noon
`
`HOOv
`
`HOHv
`
`Hch
`
`Honv
`
`Hovv
`
`Homv
`
`Howv
`
`Hone
`
`Hcov
`
`Home
`
`HOOm
`
`8800000800
`0800888488
`0080484448
`0800400000
`8040008000
`8080000084
`8048800400
`4080000004
`0480084400
`0080000848
`
`4400000400
`0400444844
`0040848884
`0400800000
`4080004000
`4040000048
`4084400800
`8040000008
`0840048800
`0040000484
`
`HOHn
`
`4440848844
`0800004408
`4088408084
`0088000000
`4404488448
`4040800480
`0400000484
`4408800400
`4004088080
`0008000000
`
`8880484488
`0400008804
`8044804048
`0044000000
`8808844884
`8080400840
`0800000848
`8804400800
`8008044040
`0004000000
`
`flown
`
`8084408000
`0880480088
`0004400004
`0080448044
`0004840044
`4004004000
`8040400400
`4800080040
`0448000440
`4400880000
`
`4048804000
`0440840044
`0008800008
`0040884088
`0008480088
`8008008000
`4080800800
`8400040080
`0884000880
`8800440000
`
`Homm
`
`0800048440
`0480408048
`4404080000
`0044088408
`8080404400
`4800040040
`0044004008
`4400008888
`8800404404
`8000004804
`
`0400084880
`0840804084
`8808040000
`0088044804
`4040808800
`8400080080
`0088008004
`8800004444
`4400808808
`4090008408
`
`Hovm
`
`0080000004
`8404084880
`8040448040
`8800880408
`4080400408
`0404044440
`0480884000
`4800048040
`4084404044
`8848004080
`
`uuauouuoua,
`4808048440
`4080884080
`4400440804
`8040800804
`0808088880
`0840448000
`8400084080
`8048808088
`4484008040
`
`damn
`
`00
`
`.wfim
`
`Regeneron Exhi
`
`it 1023.014
`
`

`

`U.S. Patent
`
`Jun.13,2006
`
`Sheet12 0f16
`
`US 7,060,269 B1
`
`
`
`
`
`080400040444000800804440844440
`
`4800804404
`8040880008
`0040040800
`0884048004
`4080048080
`4404000084
`4048008804
`
`0408888000
`0000440440
`0888800448
`0480400408
`8884440880
`8008480800
`0000084884
`8000080880
`4000000004
`4040044080
`
`0804444000
`0000880880
`0444400884
`0840800604
`a448880440
`4004840400
`0000048448
`4000040440
`8000000008
`8080088040
`
`doom
`
`0408000808
`8800040040
`8880488880
`8400408808
`4080440004
`0080080400
`0448084008
`8040084040
`8808000048
`8084004408
`
`HOhm
`
`
`
`84448008804484484880
`