8.
`
`(Original) The apparatus of claim 1, wherein the data comprises song title and artist
`
`information.
`
`9.
`
`(Original) The apparatus of claim 1, wherein the data comprises channel number and
`
`channel name information.
`
`10. (Original) The apparatus of claim 1, wherein the data comprises video information.
`
`11. (Previously'Presented) The apparatus of claim 1, wherein the formatted data is displayed as
`
`a menu on a display of the car stereo.
`
`12.
`
`(Previously Presented) The apparatus of claim 1, wherein the display of the car stereo
`
`comprises a graphic panel.
`
`13. (Original) The apparatus of claim 1, wherein the commands are input by a user using one or
`
`more control buttons or presets on the car stereo.
`
`l4. (Cancelled)
`
`15.
`
`(Previously Presented) The apparatus of claim 1, wherein audio signals from the one or
`
`more auxiliary input sources are selectively channeied to the car stereo by the interface.
`
`MEI 646875fiv.l
`
`ans-mam;sweammmwu‘xwuw.um»“my“:mtg-3wmhmzzmmumh
`
`mm“waan:ro;:z-:;ewimamrmsmmmmmarm-v.1.—
`
`awaaerxr
`1:594:13:
`
`flaxa‘t-‘aht‘ifixim'b‘flx‘fis
`
`
`umum:mama:1mm.
`a;;<:.«.:m.um.a:axemuam1."
`
`mmwax-u.-
`
`we?»rmmmwmmmu:meanzamwsmsmmmysm
`
`
`
`aflkxmwzmmrxmice.[:1thunmet-s-
`memmu;it
`
`Page 981 of 1462
`
`BMW EXHIBIT 1011
`
`

`

`16.
`
`(Previously Presented) The apparatus of claim 1, wherein a user can select between the one
`
`or more auxiliary input sources by depressing keys on the car stereo.
`
`17.
`
`(Previously Presented) The apparatus of claim 1, wherein a user can select one of the
`
`auxiliary input sources by entering a disc number at the car stereo.
`
`18.
`
`(Previously Presented) The apparatus of claim 1, wherein a user can select one of the
`
`auxiliary input sources by entering a track number at the car stereo.
`
`19.
`
`(Previously Presented) The apparatus of claim 1, wherein a user can select one of the
`
`auxiliary input sources by entering both disc and track numbers at the car stereo.
`
`20.
`
`(Previously Presented) The apparatus of claim 1, wherein a user can select between the
`
`audio device and the one or more auxiliary input sources by entering a sequence at the car stereo.
`
`21.
`
`(Original) The apparatus of claim 20, wherein the sequence comprises a track up selection
`
`followed by a track down selection.
`
`22.
`
`(Original) The apparatus of claim 1, further comprising a second interface connected to the
`
`first interface for providing a plurality of auxiliary input sources.
`
`23.
`
`(Original) The apparatus of claim 22, wherein both the first interface and the second
`
`interface are controllable using the car stereo.
`
`ME] 6468756v.l
`
`Page 982 of 1462
`
`
`eaR.anmmmm:uurmm.xgrYM
`
`
`
`g
`
`”WV-arm
`.mmmwmfia.
`
`13mm:fi.&‘&‘u:
`"xvmfiszi
`
`Page 982 of 1462
`
`

`

`24. (Currently Amended) An audio device integration system comprising:
`
`a car stereo;
`
`a plurality of auxiliary input sources;
`
`an interface connected between the car stereo and the plurality of auxiliary input sources
`
`for channeling audio from at least one of the plurality of auxiliary input sources, the interface
`
`including:
`
`means for remotely controlling at least one of the pluralitLgf auxiliary input
`
`sources using the car stereo by receiving a control command from the car stereo in a
`
`.
`
`format incompatible with the at least one of the plurality of auxiliary input sources,
`
`processing— the control command into a formatted control command compatible with the
`
`at least one of the plurality of auxiliary input sources, and transmitting the formatted
`
`control command to the at least one of the plurality of auxiliary input sources for
`
`execution thereby;
`
`means for receiving data from the at least one of the plurality of auxiliary input
`
`sources in a format incompatible with the carstereorprocessingwthe data,into,,fonnatted,, ,,
`
`data compatible With the car stereo, and transmitting the formatted data to the car stereo
`
`for display thereby; and
`
`ME] 6468756v.1
`
`Page 983 of 1462
`
`
`
`
`
`e3.1m:.
`
`
`
`i-ullifan'amimymum
`
`
`
`=::7umcnmimc.¢ew:xermflmishmmtmfitxm‘emtwmmngestatpmmeGame-14m?
`
`
`
`
`
`Page 983 of 1462
`
`

`

`means for selecting one of the plurality of auxiliary input sources from the car
`
`stereo.
`
`25. (Original) The apparatus ofclaim 24, wherein the means for selecting one of the plurality of
`
`auxiliary input sources Comprises a disc 01' track selection entered by a user using control buttons
`
`of the car stereo.
`
`26.
`
`(Previously Presented) The apparatus of claim 24, 'wherein the audio device at least one of
`
`the plurality of auxiliary input sources comprises a CD player, CD changer, MP3 player, satellite
`
`receiver, or a Digital Audio Broadcast (DAB) receiver.
`
`27.
`
`(Previously Presented) The apparatus of claim 24, wherein a device type of the at least one
`
`of the plurality of auxiliary input sources is automatically detected by the interface and the at
`
`least one of the plurality of auxiliary input sources is automatically. integrated with the car stereo
`
`based upon the device type.
`
`28.
`
`(Original) The apparatus of claim 24, wherein the interface is switchable into an auxiliary
`
`input mode by issuing a control sequence at the car stereo.
`
`29.
`
`(Original) The apparatus of claim 28, wherein the control sequence comprises a track up
`
`cemmand followed by a track down command.
`
`
`
`MEI 6463756V.l
`
`Page 984 of 17462
`
`
`
`5.1-.can?:aggwmaimmremade
`
`
`
`
`
`Page 984 of 1462
`
`

`

`30.
`
`(Currently Amended) A method for integrating an after-market device with a car stereo
`
`comprising:
`
`connecting an interface to the car stereo, the after-market device to the interface, and an
`
`auxiliary input source to the interface;
`
`remotely controlling the after-market device using the car Stereo by:
`
`receiving control commands from the car stereo at the interface in a format
`
`incompatible with the after—market device; an_d
`
`processing the control commands into formatted control commands
`
`compatible with the after-market device and dispatching the formatted control
`
`commands to the after-market device;
`
`receiving data in a format incompatibie with the car stereo and audio from the after-
`
`market deviCe at the interface; ‘
`
`processing the data into formatted data Compatible with the car Stereo and dispatching the
`
`audio and formatted data to the car stereo; -'
`
`displaying the formatted data on the car stereo and playing the audio through the car
`
`stereo; and
`
`MEI 6468756v.l
`
`Page 985 of 1462
`
`ti'werficr.
`awaits:
`wevmm-ers.
`
`5:31;m§awe»awmsvkmwmunmzsatemraemezmavgvnxfiww{mrr<ea\w
`
`
`
`aatammfiwemafiaw—m.“wrxwxwamn
`21:45,“:imimmmmfl‘fimhx‘x'ka-‘iku‘fl.
`
`g:-:1{§5$Wfi<ani
`
`
`
`.axfxxpimamm‘mrfiwwd.,
`
`
`
`atmmmrimmmmmmmmwamvxefiwwrmfiimmmrr
`
`
`
`
`
`
`
`2:1;ch:mzmz
`
`Page 985 of 1462
`
`

`

`playing audio from the ausei-harw—inpet—seuree after-market device through the car stereo.
`
`31.
`
`(Original) The method of claim 30, wherein the stepof receiving data from the device
`
`comprises retrieving CD track andtime information from the device.
`
`32.
`
`(Original) The method of claim 30, wherein the step of receiving data from the device
`
`comprises retrieving MP3 song, title, track, and time information from the device.
`
`33.
`
`(Original) The method 'of claim 30, wherein the step of receiving data from the device
`
`comprises retrieving channel number, channel name, artist, and song information from the
`
`device.
`
`-
`
`34..
`
`(Original) The method of claim 30, wherein the step of receiving data from the device
`
`comprises retrieving video information from the device.
`
`35.
`
`(Previously Presented) The method of claim 30, 'wherein the step of displaying the
`
`formatted data comprises displaying the data in an LCD panel.
`
`36.
`
`(Previously Presented) The method of claim 30,
`
`'wherein the step of displaying the
`
`formatted data comprises displaying the data in a graphical user interface at'the car stereo.
`
`MEI 6468756v.i
`
`Page 986 of 1462
`
`magamemaa.
`
`mamrrwemTgmnflso'fivlfi‘x
`
`Jim?
`
`;Q7;aqzwamwgrxxuimTthmnsrlzs:qunggdcg‘t'LfiImB-fxbt’flstanza-r
`
`
`A:..‘:.>.A.N:;::.~r.=s—=:Terammmswaaemewm
`margmmmumamamfi
`
`
`war—mu.mqrfii'nnflaw-Wecmwzxmemmx
`
`minim.
`sfafizoci-waxemn
`
`i'x'ergrtpgfifiupmmrmmx;n:;:r:c:iez‘r(mnamm
`
`7:5mmfi
`
`omen-xv,-
`ascend/ram;
`
`Page 986 of 1462
`
`

`

`
`
`{germ}:film}:
`
`mm.
`
`\|.17mmramnwmwmmaswwma
`
`
`
`51'mur—r1:5wax-aw.Karin-1r-
`
`:3:er
`
`i.:;;:.\>td:;':!x‘f:x:22:4:rx:m:»;1&vy¢:sfiifltummgwh'rewwflwlntcfim‘zn'm-marg-ataz'iflnfli
`
`
`
`i g
`
`37.
`
`(Previously Presented) The method of claim 30, wherein the step of displaying formatted
`
`data comprises displaying video at the-ear stereo.
`
`38.
`
`(Previously Presented) The method of claim 30, vvherein the step of connecting the after-
`
`market deviee to" the interface comprises connecting a CD player, CD changer, MP3 player,
`
`satellite receiver, or a Digital Audio Broadcast (DAB) receiver to the interface.
`
`39. (Cancelled)
`
`40.
`
`(Previously Presented) The method of claim 30, further comprising receiving a selection
`
`command from the car stereo and channeling data and audio from the auxiliary input source to
`
`the interface in response to the selection command.
`
`41.
`
`(Original) Themethod of claim 40, further comprising processing the data from the
`
`auxiliary input source for display on the car stereo.
`
`_10
`
`MEI 646375611
`
`Page 987 of 1462
`
`Page 987 of 1462
`
`

`

`42.
`
`(Currently Amend-ed) An apparatus for docking a portable device for integration with a car
`
`stereo comprising:
`
`a storage area remote from a car stereo for storing the portable device;
`
`a docking portion within the storage area for communicating and physically mating with
`
`the portable device;
`
`a data port in communication with the docking portion, the data port connectable with a
`
`device for integrating the portable device with the car stereo; and
`
`an interface connected to the data port and to the car stereo, the interface channeling
`
`audio from the portable device to the car stereo, the interface including means for remotely
`
`controlling the portable device using the ear stereo by processing control commands generated
`
`by the car stereo in a format incompatible with the portable device into formatted control
`
`commands compatible with the portable-device, and dispatching the formatted control commands
`
`to the portable device for execution thereby.
`
`43.
`
`(Previously Presented) The apparatus of 'claim 42, wherein the storage area further
`
`comprises atop member, “a bottom member, and a hinge intercomecting the top member and the
`
`bottom member at an edge thereof.
`
`ll
`
`MEI 6468756VJ
`
`Page 988 of 1462
`
`
`
`:xmmmmwxamuu
`.vmrxdflmammmllmmflnt
`
`‘H‘A‘V~41:
`
`
`Page 988 of 1462
`
`

`

`- 44.
`
`(Previously Presented) The apparatus of claim 42, wherein the data port comprises an RS-
`
`232 or Universal Serial Bus (USB) port.
`
`45.
`
`(Previously Presented) The apparatus of claim 42, wherein the storage area further
`
`comprises a top portion and a bottom portion defining a sleeve for holding the portable aedie
`
`device.
`
`46.
`
`(Previously Presented) The apparatus of claim 43, further comprising a clasp for retaining
`
`the top and bottom members in a closed position.
`
`47.
`
`(Currently Amended) A method of integrating an after-market device with an Original
`
`Equipment Manufacturer (OEM) or after—market car stereo comprising:
`
`- connecting the after-market device to an interface;
`
`connecting the interface to a car stereo;
`
`determining Whether the car stored is an OEM car stereo or an after-market car stereo;
`
`generating and transmitting a device presence signal to the car stereo tomaintain the car
`
`stereo in an operational state responsive to external—signals; signals generated by the after-market
`
`d
`
`evice the device presence signal based upon the car stereof
`,
`
`12
`
`ME] .6468756v.1
`
`Page 989 of 1462
`
`
`
`ems:mmrmm:mmmvmwuxw2wmwz\fifixmmmtsimizzim‘amln‘
`
`amen-1w
`
`maxxmmmwmuwfl
`.Lxcmwwtsfi;
`Hawtzmw
`Agamma
`
`mom:a».91:.
`
`
`
`.‘52;?x11;c¢x«;g<3f%22:4§:M:.c(.x\ddzxa~nx:.c:tu75554:;
`
`
`m:T»:=T=nmwetrmzfiurxflwwmwmmfimw'
`mmtmmrmmw
`
`
`
`“Maumfivmmfikfimtfihflwwrflmwawmmm‘.
`
`Page 989 of 1462
`
`

`

`channeling audio signals from the after-market device to the car stereo using the
`
`interface.
`
`48.
`
`(Previously Presented) The method of claim 47, further comprising receiving control
`
`commands from the-car stereo at the interface in a 'forrnat incompatible with the after-market
`
`device.
`
`49.
`
`(Original) The method of claim 48, further comprising converting the control COmmands
`
`into a format recognizable by the after-market audio device.
`
`'50. (Original) The method of claim 49, further comprising dispatching formatted commands to
`
`the after-market audio device for execution thereby.
`
`5-1.. (Previously Presented) The method of claim 47, further comprising converting data received
`
`at the interface from the after—market audio device in a format incompatible with the car stereo
`
`into a format compatible with the car stereo,
`
`. 52.
`
`(Original) The method of claim 51, further comprising dispiaj/ing formatted data 'on the car
`
`stereo.-
`
`53. (Original) The method of claim 52, wherein the step of displaying formatted data comprises
`
`displaying channel numbers, channel names,- titles, tracks, song names, or artist names on the car
`
`stereo.
`
`MEI 64681561 I
`
`Page 990 of 1462
`
`1 3
`
`{aswm-aamxvrczmzergru.i
`
`
`«ma—«mm:mmmmm1\\a‘¥mwmhw\m;y.
`
`«new::ivaflwxmgqég
`1M£V;L§wzszw;§t;&r.t‘
`«magma:
`
`swamammwsmmwm
`
`azazzc-z'm'r
`
`mama-.2mam,-17:23:.
`mammaaa-mr—snmi-
`
`,ifiuxfmfi'fifimimfsm'fiummmummmmuxznamurs
`
`
`
`
`mummaummmmmmnmmwmmmmmfia;
`
`
`
`Page 990 of 1462
`
`

`

`54.
`
`(Original) The method of claim 52, wherein the step of displaying formatted data comprises
`
`displaying video on the car stereo.
`
`55. (Currently Amended) An audio device integration system comprising:
`
`a car stereo;
`
`a portable MP3 player external to the car stereo;
`
`an interface connected between the car stereo and the portable MP3 player, the interface
`
`including:
`
`means for generating a device presence signal and transmitting the signal to the
`
`-
`
`;
`
`'car stereo to maintain the car stereo in an operational state;
`
`means for remotely controlling the MP3 player using the car stereo by receiving a
`
`control command from the car stereo in a format incompatible with the MP3 player,
`
`- processing the control command into a formatted control. command compatible with the
`
`MP3 player, and transmitting the formatted control command to the MP3 player for
`
`execution thereby;'and
`
`-
`
`means for transmitting audio from the portable MP3 player to the car stereo;
`
`14
`
`'
`
`ME} 6468756v.1
`
`'
`
`-
`
`Page 991 of 1462' H
`
`
`
`memark/2:4
`
`«star—2:431:54$51513.
`
`
`
`eww¢:f:a-;~nmgzwaww;mvwrzrawxfia‘iw'é‘sa‘vm‘mu5212::
`
`
`
`riffifi-(WW”finch/1m“=mwuzmrsrmammficmflmwmzm7:312
`
`a
`
`Page 991 of 1462
`
`

`

`56.
`
`(Previously Presented) The apparatus of claim 55, wherein the car stereo is an Original
`
`Equipment Manufacturer (DEM) car stereo.
`
`57.
`
`(Previously Presented) The apparatus of claim 55, wherein the car stereo is an after-market
`
`car stereo.
`
`58.
`
`(Cancelled)
`
`59.
`
`(Previously Presented)
`
`The system of claim 55, wherein the interface further
`
`includes means for receiving data from the MP3 player in a format incompatible with the car
`
`stereo, processing the data into formatted data compatible with the car stereo, and transmitting
`
`the formatted data to the car stereo for display thereby.
`
`60.
`
`(Previously Presented) The apparatus of claim 59, Vvherein the data comprises track and
`
`time information.
`
`61. (Previously Presented) The apparatus of claim 59, wherein the data comprises song title and
`
`artist information.
`
`62.
`
`(Previously'Presented) The apparatus of claim 59, wherein the commands are input by a
`
`user using one or more control buttons or presets on the car stereo.
`
`15
`
`MEI 6468756V.1
`
`Page 992 of 1462 '
`
`
`
`:rwmmmsrmmfimgmmiEmma-aw
`
`smmmammzwimtumfima
`“$5.1m“
`Himmnsmmmw“
`
`(mms;
`
`"Zfimfi'w1‘an:firms-mvxvx‘gmi‘afiraz:mvsr-na
`
`I;ii
`isF
`i:i?
`
`
`‘2;:TE£{'$:\V—Tim1‘w:mfi$vsfls
`
`vat-mmA.
`
`
`
`.”Harem.~Ammmmxufimm:
`
`
`
`Page 992 of 1462
`
`

`

`
`
`’Ffiwmmagam“
`2|:m‘wmxm‘afimx
`
`emu:
`em:
`
`
`
`3:33:5kaanxrqufiuxviafiJkg
`
`«new1.3er
`vam-
`xZEEAW
`
`
`
`éa,
`
`“mums“.“\I:
`'u'hWnbx'a'nsc
`
`i
`
`g E
`
`i
`
`
`
`%
`
`E
`
`63. (Currently Amended) _ An audio device integration system comprising:
`
`a car stereo;
`
`a satellite radio receiver external to the-car stereo;
`
`an interface connected between the car stereo and the satellite radio receiver, the interface
`
`including:
`
`means for generating a device presence signal and transmitting the signal to the
`
`car stereo to maintain the car stereo in an Operational state;
`
`means for remotely controlling the satellite radio receiver using the car stereo by
`
`receiving a control command from the car stereo in a format incompatible with the
`
`satellite radio receiver, processing the control command into a formatted control
`
`command compatible with the satellite radio receiver, and transmitting the formatted
`
`control command to the satellite radio receiver for execution thereby; and
`
`means for transmitting audio from the satellite radio receiver to the car stereo.
`
`64.
`
`(Previously Presented) The apparatus of claim 63, wherein the car stereo is an Original
`
`Equipment Manufacturer (OEM) car stereo.
`
`'
`
`15
`
`E
`
`ME] 6468?56v.1
`
`'
`
`" 'Page 993 or 1462
`
`Page 993 of 1462
`
`

`

`65. (Previously Presented) The apparatus of claim 63, wherein the car stereo is an after-market
`
`car stereo.
`
`66.
`
`(Cancelled)
`
`67.
`
`(Previously Presented)
`
`The system of claim 63, wherein the interface further
`
`includes means for receiving data from the satellite radio receiver in a format incompatible with
`
`the car stereo, processing the data into formatted data compatible with the car stereo, and
`
`transmitting the formatted data to the car stereo for display thereby.
`
`.68.
`
`(Previously Presented) The apparatus of claim 67, wherein the data comprises track and
`
`time information.
`
`69. (Previously Presented) The- apparatus of claim 67, wherein the data comprises song title and
`
`- artist information. _
`
`-70. (Previously Presented) The apparatus of claim 67, wherein the data cemprises a channel
`
`number and a channel name.
`
`71.
`
`(Previously Presented) The apparatus of claim, 67, wherein the commands are input by a
`
`user using one or morecontrol buttons or presets on the car stereo.
`
`ME] 6468756v.l
`
`17
`
`muanmmsawswgamflemran:«2.smma;
`
`
`rfifizezmmruz‘finwwmfim
`
`
`«.can;ammmmmzamxfiiifi‘fixfirmauws.
`
`
`
`Aflssfienna..-.-.aW.Mdmmmrwm-mawmmmxmIK?>'.::.=:.=_1:',_3.
`
`
`
`
`
`
`
`..~mmrmitwnmfikmmmrmmVienwa-Jza.mflnglnmmmwmimlvmtwdaumVanuatumoan
`
`
`
`Page 994 of 1462
`
`

`

`
`
`5'3
`
`i i5
`
`i 3
`
`
`
`
`
`4.3.1.fiqmwmwryfifi'mx
`
`«we:
`
`imfifim‘tlfiwcfifixurga‘s:zimnbucmuai'AtWWh“mug:
`
`
`
`
`
`mmummw..aarm...m~w~m>rwvnmwmnmw-nwrmfih‘wnnumuwt-flsmtwnvnmonvaétrwx2:{wmarmm-«m-mwmmm-Mm1
`
`.. 7.2,... (Currently. Amended) An andiO..de.Vice integrationsystem comprising:
`
`a car stereo;
`
`a digital audio'broadca'st receiver external to the car stereo;
`
`an interface connected between the car stereo and the digital audio broadcast receiver, the
`
`interface including:
`
`means for generating a device presence signal and transmitting the signal to the
`
`car stereo to maintain the car stereo in an operational state;
`
`means for remotelv controlling the digital audio broadcast receiver using the car
`
`stereo by receiving a control command from the car stereo in a format incompatible with
`
`the digital audio broadcast receiver, processing the control command into a formatted
`
`control command compatible with the digital audio broadcast receiver, and transmitting
`
`the formatted Control command to the digital audio broadcast receiver for execution
`
`thereby; and
`
`means for transmitting audio from the digital audio broadcast receiver to the car
`
`stereo.
`
`is
`
`ME] 6468756VJ
`
`Page 995 of1'462
`
`Page 995 of 1462
`
`

`

` itat
`
`g E
`
`
`
`ma;wszirfimmmmwmviflmr
`
`mmmm:
`
`'.~P35;Hmtr.\11:71:\1.n-.\1r.-r::\=(rmsacs?
`mmann:;s'=1:§‘u\fi
`
`Bmmavannrs'm’awumtanlmmmm’m’zfm‘awxa
`
`122;):
`
`2:133:43
`
`mmmaxummesawmm
`cmamfamema‘aua
`“mum...“rn(Ga:
`
` :smx‘wpu...
`
`“mus-um
`
`73.
`
`(Previously PreSented) The apparatus of claim 72, wherein the car stereo is an Original
`
`Equipment Manufacturer (GEM) car stereo.
`
`74. (Previously Presented) The apparatus of claim 72, wherein the car stereo is an after-market
`
`car stereo.
`
`75.
`
`(Cancelled)
`
`76.
`
`(Previously Presented)
`
`The system of claim 72, wherein the interface further
`
`includes means for receiving data from the digital audio broadcast receiver in a format
`
`_.:incompatible vvith the ' car stereo, processing the incompatible data into formatted data
`
`-'..eompatible With the car stereo, and transmitting the formatted data to the car stereo for display
`
`thereby.
`
`77.
`
`(Previously Presented) The apparatus of claim 76, wherein the data comprises track and
`
`time inferrnation.
`
`78. (Previously Presented) The apparatus of claim 76, wherein the data comprises song title and
`
`artist information:
`
`79.
`
`(Previously Presented) The apparatus of claim 76, \vherein the data comprises a channel
`
`number and a Channel name.
`
`19
`
`ME] 6468756v.l
`
`Page 996 of 1462
`
`Page 996 of 1462
`
`

`

`80.
`
`(Previously Presented) The apparatus of claim 76, wherein the commands are input by a
`
`user using one or more control buttons or presets on the car stereo.
`
`81.
`
`(Currently Amended) A device for integrating video information for use with a car stereo,
`
`comprising:
`
`a car stereo;
`
`a an after-market video device external to the car stereo;
`
`an interface connected between the car stereo and the alter—market video device, the
`
`~ interface including:
`
`means forfgenerating a device presence signal and transmitting the signal to'the
`
`car stereo to maintain the car stereo in an operational state; state responsive to signals
`
`generated by the after-market video device; and
`
`means fer transmitting video information from the alter-market video device to
`
`the car stereo. '
`
`i
`
`82.
`
`(Previously Presented) The device of Claim 8 1_, further comprising means for converting
`
`the video information into a format compatible with the car stereo.
`
`hex—wensvu:;.
`
`mmqar—rzm2Wmaaaanmrmnx
`
`(lwntmxlm-GE
`
`“mm.“
`
`«3mm:Jdmxijnmémnamzms
`
`
`emilmxalmmmmeanness;
`
`
`ism.exams-m:Hansen.
`
`
`
`2:::amvr-uwa?;uc-T¢1:;mfi1:11mil-:8}:n;
`uni-x.
`
`
`
`Wmmmgammsnzamwumuezmnwxamwwseemw:Att'fmmlcatnz-Audmwmzmfitaxmms‘ratxczrs
`
`
`
`
`
`20‘
`
`MEI 6468756v.1
`
`Page 997 of 1462
`
`.‘ngc‘alt-fsilfirfztxmfira
`
`Page 997 of 1462
`
`

`

`83.
`
`(Currently Amended) An audio device integration system comprising:
`
`a car stereo;
`
`a portable audio device external to the car'stereo;
`
`an interface connected between the car stereo and the portable audio device, the interface
`
`including:
`
`means for generating a device presence signal and transmitting the signal to the
`
`car stereo to maintain the car stereo in an operational State;
`
`means for remotely controlling the portable audio device using the car stereo by
`
`receiving a control command from the car stereo in a format incompatible with the
`
`portable audio device, processing the control command into a formatted control
`
`command compatible with the portable audio device, and transmitting the formatted
`
`control command to the portable audio device for execution thereby; and '
`
`means for transmitting audio from the portable audio device to the car stereo.
`
`84..
`
`(Previously Presented)
`
`‘
`
`'
`
`The apparatus of claim 83, wherein the portable. audio
`
`device comprises a portable CD player.
`
`_21
`
`ME] 6468756v.! -
`
`Page 998' of 1462 "
`
`
`
`viEi’fiflufiWis-mm»--mmmmwsm.1W;55477Fsfifio‘t7fi4fifi‘fiimm‘7i‘ffiu
`
`
`
`
`
`“(flirziiiifi-ifi)
`rmmmmifsmang
`\efiammmfis
`
`name,
`
`“saga-,Qwrrma
`Ammirmrmsmwmn‘t
`mum-mw.-
`
`rm:mfimxm‘wm
`
`mm.“M.fizmmfi'fim?"
`
`
`
`:-:a=r.:>.\<m\1%\t:z'~v.w::.aw:e-wwmmmwmwserflmma-ammwmmmwmcmswwwmL'éflamrfvx
`
`
`
`
`
`Page 998 of 1462
`
`

`

`85.
`
`(Previously Presented)
`
`The apparatus of claim 83, wherein the portable audio
`
`device comprises a portable MP3 player.
`
`86.
`
`(Previously Presented)
`
`The apparatus of claim 83, wherein the portable audio
`
`device comprises a portable satellite receiver.
`
`87.
`
`(Previously Presented)
`
`The apparatus of claim 83, wherein the portable audio
`
`device comprises a portable Digital Audio Broadcast (DAB) receiver.
`
`88.
`
`(Previously Presented) The apparatus 'of Claim 1, further comprising a bus connection
`
`‘ established between the after-market audio device and the interface.
`
`89..
`
`(Previously Presented)
`
`The apparatus of CIaim 88, wherein the bus connection
`
`Comprises a Universal Serial Bus (USB) connection.
`
`90.
`
`(Previously Presented)
`
`The apparatus of Claim 24,
`
`further comprising a bus
`
`, connection establ‘ishedlb‘etween the at least One of the plurality of auxiliary input sources and the
`
`interface.
`
`91.
`
`(Previously Presented)
`
`The apparatus of Claim 90, wherein the. bus connection
`
`comprises a Universal Serial Bus (U SB) connection. I
`
`{Vtfijhfim‘mme—‘éfivfl'mwmrmqfim'gxfiwfiwmwaAfir-tanimy;Kmfifififia‘i{Emimafifmflmxxfis‘ifi{\Eiifii,«cya
`
`rxkflxawyzefi
`criusax'm
`
`1fimfi‘dkmw;====7;1vAv—"'?¢~mfyT-17='i
`
`Aflmau‘pmrucmmlxfiz
`msm:mvmmumvmmmmmm
`
`'menwsam‘
`
`22
`
`ME] 6468756v.l
`
`Page '999'6f'i2i6i " '
`
`"
`
` .s'fivivkv-nmxv-‘u‘u.--“aw---:--'a:
`
`
`
`
`
`Page 999 of 1462
`
`

`

`92.
`
`(Previously Presented)
`
`The apparatus of Claim 55,
`
`further comprising a bus
`
`connection established between the MP3 player and the interface.
`
`93.
`
`(Previously Presented)
`
`The apparatus of Claim 92, wherein the bus connection
`
`comprises a Universal Serial Bus (USB) connection.
`
`94.
`
`(Previously Presented)
`
`The apparatus of Claim 63,
`
`further comprising a. bus.
`
`connection established between the satellite radio receiver and the interface
`
`95.
`
`(Previously Presented)
`
`The apparatus of Claim 94, wherein the bus connection
`
`' L comprises a Universal Serial Bus (USB) connection.
`
`996-.
`
`(Previously Presented) The apparatus of Claim 72, further comprising a bus connection
`
`established between the digital audio broadcast receiver'and the interface.
`
`97.
`
`(Previously Presented)
`
`The apparatus of Claim 96, wherein the bus connection
`
`comprises a UniversalSerial Bus (USB) connection.
`
`98.
`
`(Previously Presented)
`
`The apparatus of Claim 81,
`
`further comprising a bus
`
`connection eStab-lished'between the video device and the interface.
`
`99.
`
`(Previously Presented) . The apparatus of Claim .98, wherein the bus connection
`
`comprises a Univchal-écrial Bus'(USB) connection.
`
`23
`
`ME] 6468756v.l
`
`NRWWS1%1E‘YWRWW5WNwlkvflfi;‘atvfléawmm‘5wfim1“Whiteley—axes:yywxezuixzzq.
`
`we:
`
`rammvawewfivam
`
`737421233;
`
`>.\~Tfl%'v‘xl?‘$i$“
`
`“mu-1M,”u.finitrcxlflmxx‘r-‘Flt‘mmauzmanagwuanusafimtawfirflwafiz1r
`
`..man:a.“ 1.:q::£)i§fiiz‘wfim‘“notrue-finallax-memen-
`
`
`
`
`
`
`
`Page 1000 of 1462
`
`

`

`100.
`
`(Previously Presented)
`
`The apparatus of Claim 83,
`
`further comprising a bus
`
`connection established between the portable audio device and the interface.
`
`101.
`
`(Previously Presented) The apparatus of Claim 100, wherein the bus connection
`
`comprises a Universal Serial Bus (USB) connection.
`
`102..
`
`I (Previously :Presented) The apparatus of Claim 81, wherein the interface further
`
`comprises means for receiving a control signal from the car stereo in a format incompatible with
`
`the video device, processing the control signal into a formatth control signal compatible with
`
`the video device, and transmitting the formatted control signal to the video device for execution
`
`thereby.
`
`.103.
`
`(Previously Presented)
`
`_
`
`The apparatus of Claim 102, wherein the interface further
`
`comprises means for receiving data from the video device incompatible with the car stereo,
`
`processingdthe data into formatted data compatible with the car stereo, and transmitting the
`
`formatted data to the car stereo for display thereon.
`
`ME] 6468?56v.i
`
`24
`
`.
`
`. Page 1001 'of 14-6-2"
`
`.........
`
`43a":mvfiiufiiizgtkg-‘ra(s
`
`
`
`crazy."TV.naafimr&:rszx(.'sxau:vas‘cann$v$wvsfiw¢5qwfi¥asstsfifimmimv;
`
`ammn.flzfaxsrxxm&nfimung}?
`
`(mfflflfixlh
`
`7flinaamlmiimwmemr.
`
`-v~nmww:mmm;m;;msarmmtgecazxwtmi
`
`#thafwtbmfiuAWNC-imafli-yvffflimm1“.
`
`
`
`iWfifibmmmmmmmWMiwmw.
`
`Page 1001 of 1462
`
`

`

`. 104.
`
`(Currently Amended) An audio device integration system, comprising:
`
`a car stereo;
`
`a an after-market. line-level audio source external to the car stereo; and
`
`an interface connected between the car stereo and the alter—market,
`
`line level audio
`
`source, the interface including:
`
`means for generating and transmitting a device presence signal to the car
`
`Stereo to maintain the car stereo in an operational states-arid state responsive to signals
`
`generated by the after-market, line-level audio source; and
`
`
`means for transmitting audio from the after-market line-level audio source
`
`to the car stereo.
`
`
`
`:wFMfi-FiamwxWUwr—meammummrzcssnazmmmmnmmmwaw:ias,i
`
`
`
`r.arm—Ms;a
`
`mmnwam'
`:.:4:-
`
`ii
`
`
`
`sanwvmamo-ywmmwrfiwnmwwzsywnmwmwwmmkwwasm
`
`'::xwmmm(flfimvssw.s.
`
`25
`
`ME] 6468756VJ
`
`Page 1002 of 1462
`
`Page 1002 of 1462
`
`

`

`REMARKS
`
`Applicant submits this response to the outstanding Office Action on the above-identified
`
`application. Applicant has amended the claims, as set forth herein, and respectfully submits that
`
`the application, as amended, is in condition for allowance.
`
`Applicant has amended independent Claims 1, 24, 30, 42, 47, 55, 63, 72, 81, 83, and 104,
`
`and dependent Claim 6, to further define the present invention. For the reasons set forth below,
`
`Applicant submits that the pending claims are patentable over the cited references, taken alone or
`
`in any. combination.
`
`‘I.
`
`SUMMARY OF THE INVENTION
`
`Applicant’s claimed invention relates generally to an audio device integration system for
`
`integrating. one or more after-market audio devices external to a car Stereo (and, normally, not
`
`compatiblewith the car stereo), such as an MP3 player, a sateilite radio receiver, digital audio
`
`broadcast (DAB) receiver, or one or more auxiliary input sources, for use with an Original
`
`Equipment Manufacturer (OEM) or after-market car stereo system. The invention allows an
`
`external device Which is ordinarily incompatible with an OEM or after-market car stereo system
`
`to beintegrated therewith, such that the OEMor after—market car stereo system can be used to
`
`control the external device, and audio and/or Video from the external device can be channeled to
`
`the car stereo.
`
`Integration is achieved by the interface of the present invention by receiving an
`
`incompatible control command from the car stereo, processing the incompatible control
`
`command 'into a tonnatted control command compatible ‘With the external ' device, and
`
`transmitting the formatted contrOI connnand to the external device for execution thereby.
`
`ME] 6468756v.l
`
`26
`
`1mmmfimfiflmnfi333:;ngfiner:yer-(wannabes;
`
`
`
`
`'.::15=:ne'.mi%:~w~s=¢mwmm‘amxa‘
`:aawm—smmmmse:
`awaiawmawwmmmwmu
`
`
`
`,v—m—wmynmififiwmm‘fimfiwWmmwmwmmwme;em.w.m,w¢reiamfirmmz=meemmmwssr.,
`
`
`
`
`
`Page 1003 of 1462
`
`

`

`Additionally, incompatible data from the external device, such as track number, time, song name,
`
`artist name, video information, and other data,
`
`is received by the interface of the present
`
`inyention, processed: into formatted data compatible with the. car stereo, andtransmitted to-the
`car stereo for display thereby. As a result, external devices which are ordinarily alien to and
`inoperable with an existing car stereo system can be integrated for use with such systems, while
`remote command and control capabilities (cg, using the controls. of the car stereo system) are
`
`provided.
`
`I].
`
`SUMMARY OF THE REFERENCES CITED IN THE OFFICE ACTION
`
`Applicant submits that the pending claims are patentable over the references cited in the
`
`Office Action, taken alone or in combination. Specifically, Applicantsubmits that the pending
`“claims are patentable' over U.S. Patent -No.' 6,163,079 to Miy‘azaki, et al, US Patent No.
`~.6,653;,948 to Kunimatsu et a1., U.S. Patent No; 6,608,399 to McConnell et' all, U.S. Patent No.
`
`
`6,993,6l5 to Falcon, US. Patent Application Publication No. 2002/0085730 to Holland, U.S.
`
`
`Patent No. 6,591,085 to Grady, U.S. Patent No. 6,346,917 tooFuchs et al., and U.S. Patent No.
` 6,374,177 to Lee et a1.,' taken alone-or in any combination.
`
`
`Mivazaki et a1. discloses a user-operable system for a vehicle which includes a central
`
`control unit and-lone: or more detachable units which can be connected to one or more connectors
`
`positioned at various locations in the Vehicle.
`
`'In the first embodiment, the central control unit
`
`comprises an audio control unit, and the detachable unit includes a disk changer, a switch unit,
`
`and a multiple): control unit.
`
`In the secOnd embodiment, the central control: unit comprises a car
`
`navigation control unit, and the detachable unit includes a disk changer, a switch unit, and a
`
`MEI 6468,756VJ
`
`27
`
`2T.»‘3er
`
`am
`
`qrxwmmmmmmz:magma
`
`
`
`
`auras—«awaitmast-25:33mmrztfia3::1—mmcmu2;
`munitmzawmzmrsz
`1;:1gamut-1:1,“:
`newt-r
`mm21
`swam:
`rams-:2.ch
`
`:mfiwmvs
`
`Mum;-
`
`exams
`
`1mwxi—7Wmva:-=.-s-;:.—as-.\s<<¢-
`
`5:}:Tfimths-u1nzm5flrrrlfir
`
`«awfizimmw
`
`1:95:
`
`
`
`afimmfivfiofiufifififwffiéfisu‘filwfilmflfimm
`
`\R‘Jimflssii-‘AT-‘W'Firw
`:r-ra‘arramm
`
`Page 1004 of 1462
`
`

`

`liquid crystal screen and an associated swit