`Carter et al.
`
`r19J
`
`111111111111111111111111111111111111111111111111111111111111111111111111111
`US00582133 7 A
`[11] Patent Number:
`[45] Date of Patent:
`
`5,821,337
`Oct. 13, 1998
`
`(54] IMMUNOGLOBULIN VARIANTS
`lnventors: Paul J. Carter; Leonard G. Presta,
`both of San Francisco, Calif.
`
`[75]
`
`[73] As.5ignee: Genentecb, Inc., South San Francisco,
`Calif.
`
`[21] Appl. No.: 934,373
`
`[22] Filed:
`
`Aug. 21, 1992
`
`Related U.S. Application Data
`
`continuation-in-part of Ser. No. 715,272, Jun. 14, 1991,
`
`(63] Continua tion-in-par t of PCT/US92/05126 Jun. 15, 1992
`
`abandoned.
`lnt. Cl.6 ...••..••..•...•..................•...•..••..••...... C07K 16/00
`[51]
`[52] U.S. Cl .................... 530/387.3; 530/350; 530/388.2;
`424/133.1
`[58] Field of Search
`................................. 530/387.3, 350,
`530/388.2; 424/133.1
`
`[56]
`
`References Cited
`
`U.S. PATENT DOCUMENTS
`
`FOREIGN PATENT DOCUMENTS
`
`Hudziak et al., ··pl85"£Em Monoclonal Anlibody Has Anti
`prolifcrative Effects Tn Vitro and Sensi tizes Human Brea51
`1\imor Cells 10 Tumor Necrosis Factor" Molecular & Cel
`lular Biology 9(3):1165-1172 (1989).
`King et al., "Amplification of a Novel v�rbB-Related Gene
`in a Human Mammary Carcinoma" Science 229:974-976
`(1985).
`Lupu e t al., "'Direct interaction o[ a ligand for tbe erbB2
`oncogene product with Lbe EGF receptor and p l85erbBZ>•
`Science 249:1552-1555 (1990).
`MiUer, R. et al., ''Monoclonal antibody tberapeutic triaL5 in
`seven patients witb T--cell lympboma" Blood 62:988-995
`(1983).
`Roilt et al. Immunology (Gower Medical Publishing Lid.,
`London, England) p. 5.5 (1985).
`ScbrolI, R. et al., "I luman anti-murine immunoglobulin
`in patients receiving monoclonal antibody
`responses
`tberapy" Cancer Researcfl 45:879-885 (1985).
`Sbepard and Lewis, ''Resislance o[ tumor cells lo 111mor
`necrosis factor" J. Clin. lmmunol. 8(5):333-395 (1988).
`Slamon ct al., "Human Breast Cancer: Correlation of
`Relapse and Survival with Amplification of the HER-2/neu
`Oncogene" Science 235:177-182 (1987).
`Slamon et al., "Studies of Lhe HER-2/neu proto-<mcogeae in
`human breast and ovarian cancer" Science 244:707-712
`(1989).
`Yamamoto et al., ''Similarity of protein encoded by the
`
`4,816,567 3/1989 Cabilly et al. ....................... 530/387.l
`human c-erb-B-2 gene to epidermal growth factor recep
`tor" Nature 319:230-34 (1986).
`Cholhia et al., J. Mo/. Biol. 186:651-663 (1985).
`Novotny and Haber, Proc. Natl. Acad. Sci. USA
`82:4592-4596 (1985).
`Morrison, S. L. et al., Proc. Natl. Acad. Sci. USA
`81:6851-{)855 (1984).
`BouJianne, G. L. et al., Nalure 312:64.3-646 (1984).
`Neuberger, M. S. el al., Na111re 314:268-270 (1985).
`Briiggemann, M. et al.,./. Exp. Med. 166:1351-1361 (1987).
`Riechmann, L. et al., Nalure 332:323-327 (1988).
`Love el al., Methods in Enzymology 178:515-527 (1989).
`Bindon et al., J. Exp. Med. 168:127-142 (1988).
`Jones, P. T. et al., Nature 321:522-525 (1986).
`Vcrhocycn, M. et al., Science 239:1534-1536 (1988).
`Hale, G. et al., Lancet i:1394-1399 (1988).
`Queen, C. et al., Proc. Natl. A cad. Sci. USA 86:10029-10033
`(1989).
`Co et al., Proc. Natl. Acad. Sci. USA 88:2869-2873 (1991).
`Gorman ct al., Proc. Nall. Acad. Sci. USA 88:4181-4185
`(1991).
`Daugherty et al., Nucleic Acids Researcfl 19(9):2471-2476
`(1991).
`
`3/1992
`Australia.
`85058/91
`European Pa t. Off . .
`9/1987
`239400
`European Pal. Off . .
`7/1989
`323806 Al
`328404 Al
`European Pat. Off . .
`8/1989
`European Pat. Off . .
`338745 Al
`10/1989
`European Pal. Off . .
`4/1990
`365209 A2
`European Pat. Off . .
`365997 A2
`5/1990
`Europeao Pat. Off . .
`12/1990
`403156 Al
`European Pat. Off . .
`7/1991
`438310 A2
`European Pat. Off . .
`7/1991
`438312A2
`European Pat. Off . .
`8/1991
`440351 A2
`European Pat. Off . .
`10/1994
`620276
`European Pal. Off . .
`682040 Al
`11/1995
`European Pal. Off . .
`451216 Bl
`1/1996
`European Pal. Off . .
`432249 Bl
`9/1996
`WO 87/02671
`WIPO.
`5/1987
`WO 88/09344
`WIPO.
`12/1988
`
`WO 89/06692 7/1989
`WIPO.
`WO 90/07861
`WIPO.
`7/1990
`WIPO.
`WO 91/07492
`5/1991
`wrPo.
`WO 91/07500
`5/1991
`WIPO.
`WO 91/09966
`7/1991
`WIPO.
`WO 91/09967
`7/1991
`WO 91/09968
`WJPO.
`7/1991
`WIPO.
`WO 92/01047
`1/1992
`WlPO.
`WO 92/04380
`3/1992
`WO 92/04381
`WIPO.
`3/1992
`WIPO .
`WO 92/05274
`4/1992
`WIPO.
`WO 92/11018
`9/1992
`WIPO.
`WO 92/15683
`9/1992
`wrPo.
`WO 92/16562
`10/1992
`WfPO.
`WO 93/02191
`2/1993
`WIPO.
`WO 94/12214
`6/1994
`
`OTILER PUBLICATIONS
`
`Coussens et al., "Tyrosine Kinase Receptor with Extensive
`Homology 10 EGF Receptor Shares Chromosomal Location
`wilb neu Oncogene" Science 230:1132-1139 (1985).
`
`(List continued on next page.)
`
`Primary Examiner-Lila Feisee
`Assis/a!// Examiner-Minh-Tam Davis
`Attorney, Agent, or Firm-Wendy M. ll.ee
`[57]
`ABSTRACT
`Variant immunoglobuJins, particularly humanized a ntibody
`polypeptides are provided, along with methods for their
`preparation and use. Consensus immuooglobulin sequences
`and s1ruc1ural models are also provided .
`15 Claims, 12 Drawing Sheets
`
`
`
`1 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`5,821,337
`Page 2
`
`011-TER PUBLICATIONS
`Brown et al., Proc. Natl. Acad. Sci. USA 88:2663-2667
`(1991).
`Junghans el al., Cancer Research 50:1495-1502 (1990).
`Davies, D. R. el al., Ann. Rev. Biochem. 59:439-473 (1990).
`Cbothia, C. & Lesk, A. M., .l. Mot. Biol. 196:901-917
`(1987).
`Chothia, C. et al., Nature 342:877-883 (1989).
`Tramontano, A. ct al., J. Mo/. Biol. 215:175-182 (1990).
`Margolies et al., Proc. Natl. Acad. Sci. USA 72:2180-2184
`(1975).
`Pluckthun, Bio1ech110/ogy 9:545-51 (1991).
`Spiegelberg et al., Biochemisuy 9:4217-4223 (1970).
`Wallick et al., .l. Exp. Med. 168:1099-1109 (1988).
`Sox et al., Proc. Natl. Acad. Sci. USA 66:975-982 (1970).
`Jaffers, G. J. el al., Transplantation 41:572-578 (1986).
`Sberi.tI ct al., Proc. Natl. A cad. Sci. USA 84:8075-79 (1987).
`Epp et al., Biochemistry 14(22):494�952 (1975).
`Marquart et al., J. Mo/. Biol. 141:369-391 (1980).
`Furey et al., J. Mo/. Biol. 167:661-692 (1983).
`Cbotbia et al., Science 233:755-58 (1986).
`Huber et al., Nature 264:415-420 (1976).
`Bruccoleri Na/I/re 336:266 (J 988).
`Margoi et al., Ann Rev. Jmnmnol.6:535-554 (1988).
`Fendly, B. M. el al., Cancer Res. 50:1550-1558 (1990).
`Neuberger et al., Nature 312:604-608 (1984).
`Takeda et al., Nature 314:452-454 (1985).
`Snow and Amzel, Protein: Structure, Function, and Genel
`ics 1:267-279, Alan R. Liss, lnc. pubs. (1986).
`Cbeetbam, J., Pro1ein Engineering 2{3): 170-172 (1988).
`al., Journal of Biological Chemistry
`Sherman
`el
`263:4064-4074 (1988).
`AnlZel and Poljak, Ann. Rev. Biochem. 48:961-67 (1979).
`Silverton et al., Proc. Natl. Acad. Sci. USA 74:5140-5144
`(1977).
`Gregory et al., Molecular Immunology 24:821-829 (1987).
`Shalaby et al., J. Exp. Med., 175: 217-225 ( 1992).
`Mian el al., J. Mot. Biol., 217: 133-151 (1991).
`Carter ct al., Proc. Natl. Acad. Sci., 89: 4285-4289 (1992).
`Winter el al., Nafllre, 349: 293-299 (1991).
`Lazar cl al., Mo/. and Cell. Biol., 8: 1247 (1988).
`Burgess et al., J. Cell. Biol., 111: 2129 (1990).
`Tao et al., J. Jmmunol., 143(8): 2595 (1989).
`Segal ei al.,PNAS, 71: 4298-4302 (1974).
`Amil et al., "Tiiree-Dimensional Structure of an Anti
`gen-Antibody Complex al 2.8 A Resolution" Science
`233:747-753 (Aug. 1986).
`Amzel et al., "The Three Dimensional Structure of a Com
`bining Region-Ligand Complex of lmmunglobulio NEW at
`Sci. USA
`3.5-A Resolution" Proc. Natl. Acad.
`71(4):1427-1430 (Apr. 1974).
`Baselga et al., ·'Phase II Study of Weekly Intravenous
`Recombinant Humanized Anti-p185/HER2 Monoclonal
`Antibody
`in Patients With HER2/ocu-Ovcrcxpressing
`Metastatic Breast Cancer" J. Clin. Oncol. 14(3):737-744
`(1996).
`Beverley & Callard, "Distinctive functional charcteristics of
`buman T lympbocytes defined by E roselting or a mono
`clonal anli-T cell antibody" European Journal of !111111unol
`ogy 11:329-334 (1981).
`Bird et al., "Single-<:hain antigen-binding proteins" Science
`242:423-426 (Oct. 1988).
`
`Brennan cl al., <;Preparation of bispccific antibodies by
`cbcmical recombination of monoclona I immunoglobulin G1
`fragments" Science 229:81-83 (Jul. 1985).
`Bruccoleri el al., ''Structure of antibody bypervariable loops
`reproduced by a conformational search algorithm" Naftlre
`335:564-568 (Oct. 1988).
`Caron et al., "Biological and lmmuaological Features of
`Humanized M L95 (Anti-CD33) Monoclonal Antibodies"
`Cancer Research 52:6761-6767 (Dec_ 1992).
`Caner ct al., ''1-ligb level escherichia coli expression and
`production of a bivalent humanized antibody fragment"
`Bio/Teclmology 10:163-167 (1992).
`Chotbia & Lesk, "Tbe relation between lbe divergence of
`in proteins" EMBO Journal
`sequence and structure
`5(4):823-826 (1986).
`Co & Queen, "Humanized antibodies for therapy" Nawre
`351:501-502 (Jun. 1991).
`Co ei al., "Chimeric and Humanized Antibodies with Speci
`ihe CD33 Antigen" J. of !11111111nology
`ficity
`for
`148(4):1149-1154 (Feb. 1992).
`Co et al., "Humanized Anti-Lewis Y Antibodies: Lo Vitro
`Properties and Pharmacokioetics io Rhesus Monkeys" Ca11-
`cer Research 56:1118-1125 (Mar. 1996).
`Colman et al., ··Crystal and Molecular Structure of tbe
`Dimer of Variable Domains of the Bence-Jones Protein
`ROY" J. Mot. Biol. 116:73-79 (1977).
`Colman et al., ··Tbrce-dimeosional structure of a complex of
`influenza virus ncuraminidasc" Nature
`antibody witb
`326:358-363 (Mar. 1987).
`Cook et al., ''A map of the human imcnunoglbulin Vn locus
`completed by analysis of tbe lelometric region of chromo
`some 14q" Nature Genelics 7:162-168 (Jun. 1994).
`Darsley & Rees,
`sequences of five
`·'Nucleotide
`anti-lysozymc moooclooal antibodies" EMBO Journal
`4(2):393-398 (1985).
`Davies & Metzger, "Structural Basis of Antibody Function"
`Ann. Re1( !111111unol. 1:87-117 (1983).
`Davies et al., "Antibody-Antigen Complexes" Journal of
`Biological Chemistry 263(22): 10541-10544 (Aug. 1988).
`Eigenbro1 ct al., "X-Ray Structures o[ Fragments From
`Binding and Noobinding Versions. of a Humanized
`Aoti-CDl8 Antibody: Structural lndicatiolls of tbc Key
`Role of V n Residues 59 to 65" Pro1eins 18:49-62 (1994).
`Eigenbrot et al., "X-ray structures of tbe amigen-binding
`domains from three variants of humanized anli-p185l-IER2
`antibody 405 and comparison with molecular modeling" J.
`Mo/. Biol. 229:969-995 (1993).
`Ellison cl al., '·The nucleotide sequence of a human immu
`noglobulin Cv1
`gene" Nucleic Acids Research
`10(13):4071-4079 (1982).
`Emery & Adair, ·'Humanised monoclonal antibodies for
`therapeutic applications" Exp. Opin. lrl11est. Drugs
`3(3):241-251 (1994).
`Epp et al., "Crystal and Molecular Structure of a Dimer
`Composed of the Variable Portions of the Bence-Jones
`Protein REI" European.lournal of Biochemistry 45:513-524
`(1974).
`Fangcr et al., "Bispecific antibodies and targeted cellular
`cytotoxicity" Immunology Today 12(2):51-54 (1991).
`Fanger e1 al., "Cytotoxicity mediated by human Fe receptors
`for lgG" !11111111nology Today 10(3):92-99 (1989).
`Feldmann et al., "A Hypothetical Space-Filling Model of
`the V-Regions of lbe Galactan-Bindung Myeloma lmmu
`noglobulin 1539" Molecular !11111111nology 18(8):683-698
`(1981).
`
`
`
`2 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`5,821,337
`Page 3
`
`Fendley et al., ''The Extracellular Domain of HER2/ncu ls a
`Poten1ial hnmunogen for Active Specific I mmunotherapy of
`Breast Cancer" J. Biol. Resp. Mod. 9:449-455 (1990).
`Foote et al., '"Antibody Framework Residues Affecting tbe
`Conformation of the Hypervariable Loops" J. Mo/. Biol.
`224:487-499 (1992).
`Foote, J., "Humanized Antibodies" Nova <1cta Leopoldina
`61(269):103-lJO {1989).
`Glennie et al., "Preparation and Performance of Bispecific
`F(ab'y)� Aniibody Containing Thioether-Linked Fab'y Frag
`ments" J. !111111unol. 139(7):2367-2375 (Oct. 1 , 1987).
`Gonzalez et al., ·'Humanization of Murine 6G425:An
`Anti-IL8 Monoclonal Antibody Which Blocks Binding of
`Il.8 10 Human Neutrophils" 1996 Keystone Symposia on
`Exploring and Exploiting Amibody and Jg Superfa111ily
`Combining Sites (Poster) pp. 1-21 {Feb. 1996).
`Gussow & Seemann, ·'Humanization of MonoclonaJ Anti
`bodies" Meth. Enzymology, Academic Press, Inc. vol.
`203:99-121 (1991).
`Hicter ct al., .. Cloned human and mouse kappa immunoglo
`bulio constant and J region genes conserve homology in
`functionaJ segments" Ce// 22(Part 1):197-207 {1980).
`Houghton, A., "Building a better monoclonal antibody"
`Immunology Today 9(9):265-267 {1988).
`Huston et al., "Protein engineering of antibody binding sites:
`Recovery of specific activity in an anti-cligoxin single-cbain
`Fv analogue produced in Escherichia coli" Proc. Natl.
`Acad. Sci. USA 85:5879-5883 {Aug. 1988).
`Isaacs ct al., "Humanised Monoclonal Antibody Therapy for
`Rheumatoid Arthritis" Lancet 340:748--752 (Sep. 26, 1992).
`Joboson et al., "Biological aod Molecular Modeling Studies
`Comparing Murine Monoclonal Antibodies with Their Engi
`neered Chimeric and Humaoizecl Counterparts" J. Cell.
`Biochem. Suppl 0 (13 Parr A) {18tb Ano. UCLA Syrop on
`Mo!. & Cell. Biol., Park City, UT Jan. 17-22, 1989) p. 87
`(1989).
`Kabat E., "Origins of Antibody Complementarity and Speci
`fici1y -Hypervariable Regions and the Minigenen Hypo1.h
`esis" J. of J111munology 125(3):961-969 {Sep. 1980).
`Kabat cl al. Sequences of Proteins of !11111111nologicnl Inter
`est, U.S. Dept. of Heahb and Human Services, NIH, 5th
`edition vol. 1:103-108, 324-331 (1991).
`Kabat et al., ·'Sequences of Proteins of I mmunological
`Interest'', Betbescla, MD:Natiooal lostitute of Health pp.
`14-32 {1983).
`Kabat et al., "Sequences of Proteins of Immunological
`Interest, 4th Edition" pp. iii-xxvii, 41-76, 160-175 ( 1987).
`Kcttlcborougb ct al., "Humanization of a Mouse Mono
`clonal Antibody by CDR-graft ing: tbe
`I mportance of
`Framework Residues on Loop Conformation" Protein Engi
`neering 4(7):773-783 (1991).
`Kindt & Capra The Amibody Enigma, New York:Pleoum
`Press pp. 79-86 (1984).
`Lcsk & Chothia, "Evolulioo of Proteins Formed by
`13-Sheets" J. Mo/. Biol. 160:325-342 (1982).
`Lcsk & Cbothia, "Tbc response of protein structures lo
`amino-acid sequence changes" Phil. Trans. R. Soc. Lond. A
`317:345-356 {1986).
`Maeda et al., "Construction of Reshaped Human Antibodies
`with HIV-neutralizing Activity" Hum. Antibod. Hybrido
`mas 2:124-134 (Jul. 1991).
`Mariuzza el al., "The Structure Basis of Antigen-Antibody
`Recognition" Ann. Re1i Biophys. Biophys. Chem.
`16:139-159 (1987).
`
`Nadler ct al., ·•1mmuoogenici1y of Ifamanizecl and Human
`Moooclooal Antibodies" C/in. Plwrmncology & Therapeu
`tics p. 180 (Feb. 1994).
`Nelson, H., "Targeted Cellular lmmuootberapy witb Bifunc
`liooal Antibodies" Cancer Cells 3:163-172 (1991).
`Neuberger el al., .. Antibody Engineering" Proceedings 8th
`Intl. Biotech. Symp., Paris 11:792-799 (1988).
`Newmark, P., ''Making Cbimeric Antibodies Even More
`Human" Bio/Tec/mology 6:468 (May 1988).
`Nishimura et al., "Human c-erbB-2 Prolo-Oocogeoe Prod
`uct as a Target for Bispecific-Antibody-Directecl Adoptive
`Tumor Immunothcrapy" Int. J. Cancer 50:80�04 (1992).
`Nina et al., "Preliminary trial of specific 1argeting therapy
`against malignant glioma" Lancet 335(8686):368-371 (Feb.
`17, 1990).
`Nitta, T. et al., "Bispecific F{ab')::. monomer prepared with
`anti-CD3 aod anti-tumor monoclonal antibodies is most
`potent in induction of cytolysis of human T cells" European
`Journal of lmmunology 19: 1437-1441 (1989).
`Nolan ct al., "Bifuoctional antibodies: concept, production
`and applications" Bioc/1imica et BiophysicaActa 1040:1-11
`(1990).
`Orlandi et al., ''Cloning Jmmunoglobulio Variable Domains
`for Expression by 1be Polymerase Clhain Reaction" Proc.
`Natl. Acad. Sci. USA 86:3833-3837 (May 1989).
`Orlandi et al., "Cloning of cDNA Correspondiog to Heavy
`and Light Chain Immunoglobulin Variable Domains" Pro
`tein and Plwrmacelllical Engineering p. 90 (1989).
`Ostberg & Queen, "Human and humanized monoclonal
`antibodies: preclinical studies and clinical experience" Bio
`chem. Soc. Transactions pp. 1038-1043 {1995).
`Padlao e1 al., "Model- building Studies of Antigeo-binding
`Sites:The Hapteo-biodiog Site of MOPC-315" Cold
`Springs Harbor Symposia On Quantitafil'e Biology
`XLI:627-637 {1977).
`Padlao, E., "Anatomy of the Aolibody Molecule" Molecular
`Immunology 31(3):169-217 {1994).
`Padlan, E., "Evaluation of !he Structural Variation Among
`Ligbt Cbain Variable Domains" Molecular !11111111nology
`16:287-296 (1979).
`Palm & Hilscbmann, ·'Primary structure of a crystalline
`monoclonal immunoglob ulio K-type L-chaio, subgroup I
`(Bence-Jones preotin Rei); isolation & characteriza1ioo of
`tbe tryptic peptides: . . . " Hoppes-Sey/er's Z. Physio/.
`Chem. 356:167-191 (Feb. 1975).
`Palm & 1-lilschmann, "The primary structure of a crystalline,
`monoclonal immunoglobulin-L-chaio of the x-type, sub
`group I (Bence-Jones Pro1ein Rei): a cootributioo to tbe
`elucida1ion of the three-climensional structure of the immu
`noglobulins" 1-loppe-Seyler's Z. Physiol. Chem.
`354:1651-1654 (Dec. 1973).
`Panka et al., ··variable region framework differences result
`in dccreasccl or increased affinity of variant anti-<ligoxi n
`an1ibodics" Proc. Natl. Acad. Sci. USA 85:3080-3084 (May
`1988).
`Presta cl al., "Humanization of an Antibody Directed
`Against lgE" J. J111111unol. 151(5):2623-2632 (Sep. l, 1993).
`Preval & Fougcreau, "Specific Interaction between VH and
`VL Regions of Human Monoclonal lmmuooglobulins" J.
`Mo/. Biol. 102:657-678 (1976).
`Queen ct al., "Construction of Humanized Antibodies and
`Testing in Primates" J. Cell. Bioc/1em. Suppl. 15 (Part E)
`(20th Ano. Mtg. Keystone Syrup. Denver, CO Mar. 10-16,
`1991) p. 137 (1991).
`
`
`
`3 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`5,821,337
`Page 4
`
`Queen et al., "Humaoiscd antibodies to 1hc IL-2 receptor"
`Prolein Eng. Antibody Mo!. Prophyl. Tiler. Appl. Man,
`Clark, M., Nollingham, UK:Acaclcmic Titles pp. 159-170
`(1993).
`Rhodes & Bircb, "Large-Scale Produclion of Proteins from
`Mammalian Cells" Bio/Teclinology 6:518, 521, 523 (May
`1988).
`Riechmann, "Humanizing of Recombinanl Anliboclies"
`(Jn11. Symp. on Clio. Appl. of Monoclonal Antibodies,
`Guildford, England) pp. 33-34 (Sep. 1987).
`Riechmano el al, "Expres.sioo of an An1ibody Fv Fragmeot
`in Myeloma Cells" J. Mo!. Biol. 203:825-828 (1988).
`Roberls & Rees, "Generation of an ao1ibocly with eohanced
`affinity and specificity for its antigeo by protein engineer
`ing" Nature 328:731-734 (Aug. 1987).
`Rostapshov el al., "Effec1ive me1hod for obtaining long
`nucleotide chains on panially complementary templates"
`FEBS Letters 249(2):379-382 (Jun. 1989).
`Rou1ledge et al., "A Humanized Monovalcn1 CD3 Ao1ibody
`which Can Activate Homologous Complemen1" European
`Journ(lf of l11111111no/ogy 21:2717-2725 (1991).
`Saul et at., "Preliminary refinement and struc1ural analysis
`of lbe Fab fragment from bumao immonoglobulin new at 2.0
`of Biological Chemistry
`resolution" Journal
`A
`253(2):585-597 (Jan. 25, 1978).
`Schoeider et al., ''The Aoti-ldiotypic Respoose by Cyno
`molgus Moodkeys to Humanized Anti-Tac ls Primarily
`Directed lo Complementarity-Determiniog Regions Hl, I-12,
`and L.3" J. of /11111111nology 150:3086-3090 (Apr. 1993).
`Sedlacek et al., "Monoclonal Antibodies
`in Tumor
`Therapy", Karger pp. 119-126, 133-179 (1988).
`Shearman et al., "Construction, Expression and Character
`ization of Humanized Ao1iboclies Directed Againsl ibe
`.I.
`l111111unol.
`T Cell
`Human a/�
`Receptor"
`147(12):4366-4373 Dec. 15, 1991).
`Shields e1 al., "lnbibi1ion of Allergic Reactions with Anti
`bodies 10 IgE" International Archives of Allergy and 111111111-
`nology J 07(1-3):308-312 (May 1995).
`Sims ct al., "A Humanized CD18 An1ibody Can Block
`Function Without Cell Des1ruction" The Journal of 111111111-
`nology 15 1(4):2296-2308 (Aug. 1993).
`Smith-Gill et al., "A Three-dimensional Model of an
`Anli-lysozyme Antibody" Mo!. Biol. 194:713-724 (1987).
`Songsivilai et al., "Bispecific antibody: a 1001 for diagnosis
`and treatmcnl of disease" Clin. Exp. l1111111mol. 79:315-321
`(1990).
`Stanford, "A Predictive Method for Determining Possible
`Three-dimensional Foldings of lmmunoglobulin Backbones
`Theor. Biol.
`Around Antibody Combining Sites"
`88:421-439 (1981).
`Stickney et al., "Bifonctional Antibody: ZCE/CHA1111ndium
`BLEDTA-IV Clinical Imaging in Colorectal Carcinoma"
`Antibody, fm1111mo Radiop!tarm 2:1-13 (1989).
`Tempest et al., "Reshaping a Human Monoclonal Antibody
`to Inhibit Human Respiratory Syncylial Virus infection Io
`Vivo'' Bio/Technology 9: 266-271 (Mar. 1991).
`Tigbe et al., ·'Delayed Allograft Rejec1ion io Primates
`Treated with Anti-IL-2 Receptor Monoclonal antibody
`,
`. 1i·ansplantation 45(1):226-228 (Jan. 1988).
`Campa1b-6
`Verhoeyen & Riecbmann, "Engineering of Antibodies"
`BioEssays 8(2):74-78 (Feb./Mar. 1988).
`
`Verhocyen cl al., "Grafling 1-Iypervariable Regions in Anti
`bodies" Protein Struc//lre, Folding, and Design 2 (Proc.
`DuPont-UCLA Syrop. Streamboat Springs, CO, Apr. 4-11,
`1987), Dale L. Oxender, New York:Alan R. Liss, Inc. pp.,
`501-502 (1987).
`
`Verboeyen et al., "Re-shaped human aoti-PLAP antibodies"
`Monoclonal Antibodies Applications in clinical oncology,
`Epenetos, lsi edition, Chapman & llall Medical pp. 37-43
`(l991).
`Ward el al., "Expression and Secrclion of Repertoires of VH
`Domains i Esclterchia Coli: Isolation of Antigen Binding
`Activitcs" Progress in Immunology (7th Intl. Congress
`Lmmunol. Berlin, W. Germany), F. Melcbers vol.
`VJJ:1144-115 1 (1989).
`
`Ward, E.S. el al., "Binding aclivities of a repetoire of single
`immunoglobulin variable domains secreted from Escheri
`chia coli .. Nmure 34 J :544-546 (1989).
`
`Werther et al., ''Humanization of an An1i-Lymphocy1e Func
`tion-Associated Ao1igen (LFA)-1 Monoclonal Antibody
`and Rcengioceriog of tbe Humanized An1ibody for Binding
`to Rhesus LFA-1" J. of 1111111unology 157:4986-4995 (1996).
`
`·'Construction and Expression of A
`Wbi1tle e1 al.,
`CDR-Grafted Anii-TNF Antibody" J. Cell. Bioc/1e111. Suppl.
`0 (Syrop. on Protein and Pharm. Eng. Mol. Cell. Biol. Park
`Ci1y, Utah) 13 Pan A:96 (1989).
`Winter & Neuberger, "Restructuring Enzymes aod Antibod
`ies" Investigation and Exploitation of Artlibody Combining
`Sites, Eric Reid, Plenum Press pp. 139-140 (1985 ).
`
`Winier et al., "Protein Engineering by Site Directed
`Mutagcnesis" Chemical Synthesis in Molecular Biology, H.
`Blocker e1 al., VCH pp. 189-197 (1987).
`,
`' Phil. Trans. R. Soc.
`Winier G., ''Antibody Engineering
`Lond. B 324:99-109 (1 989).
`
`Woodle et al., ''Humanized OKT3 Antibodies: Successful
`Transfer of Immune Modulation Properties and ldiotype
`Exprcs.sion" J. of Immunology 148(9):2756-2763 (May
`1992).
`
`O'Connor el al., "Calcium Dcpendance of an Aoli-Proteio C
`Involves Framework Residues"
`Humanized An1ibody
`(manuscripl) 1996, 37 pps.
`
`Presta et al., "Humanization of an anti-VEGF monoclonal
`anlibody for 1be therapy of solid tumors and other disorders"
`Cancer Researc!t (in prcs.s) pp. 1-32 (1997) oow published
`57(20):4593-4599 (Oc1. 1.5, 1997).
`
`Riechmano, "Dcclaral ion" from EP Opposition to EP Patent
`No. 451,261 Bl (Oct. 22, 1996) 10 pages.
`
`Riechmaon & Wiater, .. Recombioant Antibodies" (U. of
`London Royal Pos1graduate Medical School, Wolfson Lnsti
`lute, Abstrac1) (May 1987) Br. J. Cancer 56:509.
`Riechmann et al. A ligment of VL Sequences (1988) 1 page.
`Vcrhoeycn el al., "Humanising Mouse An1ibodics: A Pro1ein
`Engineeriog Approach" Soc. for Analytical Cytology (Xlltb
`ln11. Mtg. for tbe Soc. for Analytical Cytology, Cambridge,
`UK) p. 22 and slide presea1ed at mtg (1987).
`Clark et al. Eur. Journal of Immunology 19:381-388 1989.
`
`Harris et al. TII3TECH Feb. 1993 vol. 11 pp. 42-44.
`
`Waldmann Science vol. 252 p.1657. 1991.
`
`
`
`4 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`FIG. 1A
`
`405
`
`HU405
`
`HUVLKI
`
`50
`40
`30
`20
`10
`OIVMTQSHKFMSTSVGORVSITCKASQDVNTAVAWYQQKPGHSPKLLIYSASFRYT
`I
`I I I I I
`I
`I I
`I I I
`I I I I
`I I I
`I
`I
`I
`I I
`OIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLES
`II II
`I I
`I I
`II II
`DIQMTQSPSSLSASVGDRVTITCRASQDVSSYLAWYQQKPGKAPKLLIYAASSLES
`
`I
`I
`
`VL-CDRl
`
`VL-CDR2
`
`405
`
`HU405
`
`HUVLl(I
`
`100
`90
`80
`70
`60
`GVPDRFTGNRSGTDFTFTISSVQAEDLAVYYCQQHYTTPPTFGGGTKLEIKRA
`I
`I
`I I
`I
`I
`I
`I
`I
`I
`I
`I
`I I
`I
`I I
`I I
`I
`I
`I
`GVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRT
`I I I I
`I
`I
`I
`I II I I
`GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSLPYTFGQGTKVEIKRT
`
`VL-CDR3
`
`•
`
`� • 'J:J
`� � ..... �
`
`=
`.....
`
`0
`fl
`.....
`��
`
`..... IC IC QO
`
`.....
`
`"1 :r ("!) � .....
`0 � ..... N
`
`VI ... 00 N
`� ... �
`�
`-.....l
`
`
`
`5 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`FIG 18
`
`405
`
`HU405
`
`HUV HIII
`
`40
`30
`20
`10
`50 A
`EVQLQQSGPELVKPGASLKLSCTASGFNIKOTYIHWVKQRPEQGLEWIGRIYPTN
`I
`I
`I I
`I I
`I I
`I I
`I
`I
`I
`I
`I
`I
`I I
`I I
`I I
`I
`I
`I
`I
`I I
`EVQLVESGGGLVQPGGSLRLSCAA SGFNIKDTYIHWVRQAPGKGLEWVARIYPTN
`I I I
`I I I I
`I
`I I I I
`I I I
`I I I I
`I
`I I I I
`EVQLVESGGGLVQPGGSLRLSCAASGFTFSOYAMSWVRQAPGKGLEWVAVISENG
`
`Vff-CDR1
`
`Vu-CDR2
`
`405
`
`HU405
`
`HUV HIII
`
`90
`80 ABC
`70
`60
`lOOABC
`GYTRYOPKFQOKATITAOTSSNTAYLQVSRLTSEOTAVYYCSRWGGOGFYAMDYW
`I I I I I I I I
`I I I
`I I
`I
`I
`I
`I I I
`I I
`I I I I I I I I
`I
`I
`I
`GYTRYAOSVKGRFTISADTSKNTAYLQMNSLRAEOTAVYYCSRWGGDGFYAMDVW
`I I I I I I
`I
`I I
`I
`I
`I
`I I
`I
`I
`I
`I
`I
`I I
`I l I II I
`I I
`I
`SOTYYAOSVKGRFTISRDDSKNTLYLQMNSLRAEDTAVYYCARORGGAVSYFOVW
`
`405
`
`HU4D5
`
`110
`GQGASVTVSS
`I I
`I I
`GQGTLVTVSS
`
`HUVHIII
`
`GQGTLVTVSS
`
`Vu-CDR3
`
`.
`
`d • rJ).
`� � � �
`
`=
`�
`
`0
`(') !""'
`.....
`��
`.... \C \C 00
`
`Cl) er � � .... N
`0 �
`..... N
`
`01
`.... oe N
`�
`.... w
`w
`....._J
`
`
`
`6 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`U.S. Patent
`
`Oct. 13, 1998
`
`Sheet 3of 12
`
`5,821,337
`
`Anneal huVL or huVH oligomers
`to pAKl template
`3·---A----A----A----A----A-� 5'
`_________ ....,. __________ ____ _
`/
`1. Ligate
`2. Isolate assembled oligomers
`(Xhol-; Stu/+)
`3. Anneal to pAKl template
`4. Extend and ligate
`
`l. Transform E. coli
`2. Isolate
`phagemid pool
`3. Enrich for huVL and huVH(Xho I "t; Stu/-)
`4. Sequence verify
`
`Xho/
`
`FIG. 2
`
`pAK2
`
`
`
`7 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`U.S. Patent
`
`Oct. 13, 1998
`
`Sheet 4 of12
`
`5,821,337
`
`100
`
`- c::
`8 0 80
`... ·-c -0 �
`() .... ....... � 0;.::::
`- 8
`5 Q.
`(.) - 60
`�o 0.. ()
`
`40
`
`huMAb4D5-8
`
`muMAb4D5
`
`4
`
`8
`12
`[MAb4D5 variant] µg/ml
`
`16
`
`FIG. 3
`
`
`
`8 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`U.S. Patent
`
`Oct. 13, 1998
`
`Sheet 5of 12
`
`5,821,337
`
`FIG 4
`
`
`
`9 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`U.S. Patent
`
`Oct. 13, 1998
`
`Sheet 6of 12
`
`5,821,337
`
`VL
`40
`30
`10
`20
`muxCD3
`OIQMTQTTSSLSASLGDRVTISCRASQOIRNYLNwYQQKP
`**
`•
`*
`huxC03vl
`DIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKP
`# # #
`hUKI
`
`DIQMTQSPSSLSASVGORVTITCBASOSISNYI.AWY
`QQKP6
`AAAAAAAA
`CDR-Ll
`
`so
`70
`80
`60
`muxCD3
`
`DGTVKLLIYYTSRLHSGVPSKFSGSGSGTDYSLTISNLEQ
`*
`*
`* **
`*
`****
`huxCD3vl
`GKAPKLLIYYTSRLESGVPSRFSGSGSGTOYTLTISSLQP
`## #
`#
`huKI
`GKAPKLLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQP
`,..,..,..
`CDR-L2
`
`90
`100
`muxC03
`EDIATYFCQQGNTLPWTFAGGTKLEIK
`*
`*
`**
`*
`huxCD3vl
`
`EOFATYYCQQGNTLPWTFGQGTKVEIK
`# #
`hul(I
`EDFATYYCOOYNSLPWT
`FGQGTKVEIK
`
`Vu muxC03
`40
`20
`10
`30
`EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNwvKQS
`** ** * * *** *
`* *
`huxcoJvl
`EVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQA
`I# ## # #
`huIII
`EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAHSWVRQA
`
`60
`50
`70
`muxCD3
`HGKNLEWMGLINPYKGVSTYNQKFKDKATLTVDKSSSTAY
`* *
`**
`* **** ** **
`**
`huxCDJvl
`
`PGKGLEWVALINPYKGVTTYAOSVKGRFTISVDKSKNTAY
`## #### # #
`# #
`I
`HuIII
`PGKGLEWVSVISGOGGSTYYADSYKG
`RFTISRDNSKNTLY
`AAAA
`CDR-H2
`
`lOOabcde 110
`90
`80 abc
`muxCD3
`TVTVSS
`MELLSLTSEDSAVYYCARSGYYGDSOWYFOVWGAGT
`* *
`**** ** *
`huxCOJvl
`LQMNSLRAEDTAVYYCARSGYYGOSOWYFDVWGQGTLVTVSS
`########### #
`huIII
`TVSS
`LQMNSLRAEDTAVYYCARGRVGYSLSGLYDYWGQGTLV
`p ET S
`AAAAAAAAAAA
`COR-HJ
`
`FIG. 5
`
`
`
`10 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`H52H4-160
`
`pH52-8.0
`
`FIG. 6A-1
`
`30
`10
`20
`QVQLQQSGPELVKPGASVKISCKTSGYTFTE
`·*** ·** **·**·*···** ********
`MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCATSGYTFTE
`10
`20
`30
`40
`50
`
`H52H4-160
`
`pH52-8.0
`
`80
`70
`60
`50
`40
`YTMHWMKQSHGKSLEWIGGFNPI<NGGSSHNQRFMDKATLAVDKSTSTAYM
`******·*· **·***··*·******·********· *··**********
`YTMHWMRQAPGKGLEWVAGINPKNGGTSHNQRFMDRFTISVDKSTSTAYM
`60
`100
`70
`80
`90
`
`H52H4-160
`
`_ pH52-8. 0
`
`130
`120
`110
`100
`90
`ELRSLTSEDSGIYYCARWRGLNYGFDVRYFDVWGAGTTVTVSSASTKGPS
`. . ** ·**···********************** ** ************
`QMNSLRAEDTAVYYCARWRGLNYGFDVRYFDVWGQGTLVTVSSASTKGPS
`110
`120
`130
`140
`150
`
`H52H4-160
`
`pH52-8.0
`
`180
`170
`160
`150
`140
`VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
`****** *·*** ·************************************
`VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
`160
`170
`180
`190
`200
`
`H52H4-160
`
`pH52-8.0
`
`H52H4-160
`
`pH52-8.0
`
`230
`220
`210
`200
`190
`QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH
`************** **··***** ***·********** ** * *
`QSSGLYSLSSVVTVTSSNFGTQTYTCNVDHKPSNTKVDKTVERKCC---V
`210
`230
`220
`240
`240
`250
`270
`280
`260
`TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
`******* ··*************************************·
`ECPPCPAPP-VAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQ
`250
`260
`270
`280
`290
`
`•
`
`0
`• 00
`� � ..... n>
`
`=
`.....
`
`0
`(") !""'
`....
`��
`.... \0 �
`
`00 ==� � .....
`0 ..., .... N
`
`--.l
`
`(JI ,,.. oe N
`� ,,.. w
`w
`.....:.
`
`
`
`11 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`FIG 6A-2
`
`H52H4-160
`
`pH52-8.0
`
`330
`320
`310
`300
`290
`FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
`*******· *************·***·********·***************
`FNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVS
`300
`310
`320
`330
`340
`
`HS2H4-160
`
`pH52-8.0
`
`H52H4-160
`
`pH52-8.0
`
`HS2H4-160
`
`pH52-8.0
`
`380
`370
`340
`360
`350
`NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
`**·***********·***********************************
`NKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYP
`350
`360
`370
`380
`390
`
`430
`420
`410
`400
`390
`SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
`**********************·***************************
`SDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFS
`400
`410
`420
`430
`440
`
`450
`440
`CSVMHEALHNHYTQKSLSLSPGK
`***********************
`CSVMHEALHNHYTQKSLSLSPGK
`460
`450
`
`•
`
`0
`• rJ'l
`� � ..... �
`
`=
`.....
`
`0
`�
`......
`�(;)
`
`...... '° '° 00
`
`00 =� r> ...
`0 ....., ...... N
`
`00
`
`Ul ... QC
`N
`� ... (M
`(M
`....:a
`
`
`
`12 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`RG. 68
`
`H52L6-158
`
`10
`30
`20
`DVQMTQTTSSLSASLGDRVTINCRASQDINN
`*·****· ******·****** *********
`pH52-9.0 MGWSCIILFLVATATGVHSDIQMTQSPSSLSASVGDRVTITCRASQDINN
`10
`20
`30
`40
`50
`
`80
`70
`60
`50
`40
`HS2L6-158 YLNWYQQKPNGTVKLLIYYTSTLHSGVPSRFSGSGSGTDYSLTISNLDQE
`*********
`• ***************************·****·*· *
`pH52-9.0 YLNWYQQKPGKAPKLLIYYTSTLHSGVPSRFSGSGSGTDYTLTISSLQPE
`60
`70
`80
`90
`100
`
`130
`120
`110
`100
`90
`H52L6-158 DIATYFCQQGNTLPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
`*·***·************ *•·····························
`pH52-9.0 DFATYYCQQGNTLPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
`110
`120
`130
`140
`150
`
`150
`140
`180
`170
`160
`H52L6-158 VVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
`••••••••••••••••••••••••••••••••••••••••••••••••••
`pHS2-9.0 VVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
`160
`170
`180
`190
`200
`
`H52L6-158
`
`pH52-9.0
`
`210
`200
`190
`SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
`•••••••••••••••••••••••••••••••••
`SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
`230
`220
`210
`
`d
`• IJ1
`.
`� � � �
`
`=
`�
`
`0
`(') �
`.....
`�w
`..... � � 00
`
`00 =� � ...
`0 � ..... N
`
`�
`
`tll -.. QC
`N
`.......
`-.. w
`w
`'-l
`
`
`
`13 of 76
`
`Celltrion, Inc. 1144
`Celltrion v. Genentech
`IPR2017-01374
`
`
`
`U.S. Patent
`
`Oct. 13, 1998
`
`Sheet 10 of 12
`
`5,821,337
`
`FIG. 7A-1
`
`verA.hcfabl
`verI.hcfab2
`verN. hcfab!
`
`lEVQLVBSGGGLVQPGGSLRLSCATSGYTFTEYTMHWMRQAPGKGLBWVAG
`1 EVQLVESGGGLVQPGGSLRLSCATSGYTFTEYTMHWMRQAPGKGLBWVAG
`1 EVQLVESGGGLVQPGGSLRLSCATSGYTFTEY'IMHWMRQAPGKGLEWVAG
`verO.hcfab
`1 EVQLVBSGGGLVQPGGSLRLSCATSGYTFTEYTMHWMRQAPGKGLBWVAG
`verO.hcfab25
`1 EVQLVBSGGGLVQPGGSLRLSCATSGYTFTEY'IMHWMRQAPGKGLBWVAG
`verP. hcfab 6
`1 EVQLVBSGGGLVQPGGSLRLSCATSGYTFTBYTMHWMR.QAPGKGLEWVAG
`verR.hcfab�
`verQ. hcfab 7
`1 EVQLVBSGGGLVQPGG SLRLSCATSGYTFTBY'IMHWMRQAPGKGLEWVAG
`1 EVQLVBSGGGLVQPGG SLRLSCATSGYTFTBY'IMHWMRQAPGKGLBWVAG
`vers. hcfab10
`1 EVQLQQSGPBLVQPGGSLRLSCATSGYTFTBYTMHWMRQAPG
`KGLEWVAG
`verT .hcfab
`1 EVQLV