`
`121 no
`
`AS
`
`STATE OR SHEETS TOTAL
`
`INOEP.
`
`FILING FEE
`
`AITORNEY'S
`
`~' ii ..
`
`~~
`- - '-:ii~
`
`1
`
`{'
`
`j'l...
`
`\iJ...:.
`
`;-
`.,,
`
`'
`-,FQreign priority claimed
`
`~ -r-. r
`
`n0·
`~
`
`. --1 · 1
`
`'i
`
`•I l
`
`!~~
`
`_-a_.,.;.:_:.,r~,,,-~.,;;jf,;;;;1d;.9 Ack-~,:..
`• ..;.~,:..~;;.._:;.:~:.;.;,et-.,:~:;:=y~e:::;i::::e1':..:~:.:ln~itial=".°=S::......L.-F-IL_E,::~;._L-c-o_u_N_TR_v_.._O_RWGS __ ·..a;..~~..;;,;;_LA'-'"-::_s_~CU\-(..:.;'_'M'-/~--...... R_E_c_e_1VE_o __ _....._o_oc_KET __ N_O_. ___ - {~
`- -. -,-... 7'~·-- -.....:...-~-:---':-:"'·:·--- _.,,,....;._-':",~·:-r---·
`,·.,
`
`· . ;
`
`,.\
`
`"' "
`
`>ARTS(; F AP.->UCATION
`FILEO Sf 'Af1.P:'ELY
`
`-.>~
`....
`-~ .. ?>-~
`U.S. OEPT. OFCOMMJPAT. 8 TM-PT0-436L (Aev.12:..9~ './;~~·
`
`I 9:.c~.51c=-- -~;~
`
`Assist;,nt Examiner
`
`.\!) (.
`
`t- t!;·-.:· /:
`
`A,>plication;; Examiner
`CLAIMS ALLOWED
`Total Claims
`
`I Print ~laim
`
`1
`
`I
`
`DRAWING
`S'1eets Drwg. I Figs. Dr.vg.
`,;
`I
`;£
`
`.
`
`Primary Examiner
`
`ISSUE
`BATCli
`NUMBER
`
`WARNl·'4G: .,.i 1t rnforma!ion disclose:! tierein may be reslricted. Unauthorized disclosure may be prohibited
`i.Jy ti>e United States Code Tille 35, Sections 122, 181and368. Possession outside the U.S.
`Pate11t & Trademark Office is restrictac. to authorized employees and contractors only
`
`L ~1 •
`
`: r
`
`~~:~t: J:;.
`\t .. ~.<i.-: ..
`, <ti~ ·'
`L~; -~: ;~~\.
`rf1~,:c~·
`t.1ii~~'.'.:.
`
`.... ~~ :1::.:~.
`
`..
`
`• ~·....._
`
`I ' : '
`
`''-
`
`NOTICE ); •.!.LOl'IANCE MAILED
`I . . . ,,. I:·.
`)
`'
`~----~------------------1-
`'">5UE ::EE
`\rm·: ·~t.l, ,-~~1 Dat-e-"a--id--.-i~-J_,
`
`.. / <·_ : ...
`
`·s,
`
`!·~!,.
`
`~ (· ~-~~
`
`Label
`Area
`
`.,,... PT0-436A
`<ev. 8192;
`
`... -~-
`
`(F.~.C:E)
`
`v.4.
`f.,~·~v ..
`(0"' .
`.
`:. :~~
`i,(~'L
`!('£.":
`:r·
`r~ ... ,,.·
`: -..;
`
`----L-
`
`1 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`A TENT NUMBER
`
`·-
`-
`
`CLASS
`
`ORIGINP~l CLASSIFICA flON
`SUl3CLASS
`>-50
`
`s/7. j'
`
`APPLICATION SERIAL NUMBER
`
`A~ICA~~T'S NAME (PLEASE PRINT)
`
`b 'l /11(6 .20 6
`e1+{{i £fl A J
`
`,, REiSSUE, ORIGINAL PATENT NUMBER
`
`CLASS
`/.j ~ !-
`\?c
`/J2b
`.
`
`CROSS REFERENCE(S)
`~UBCLASS
`!ONE SUHCLASS PER BLOCKl
`7CJ . .P/
`
`/?_ '7
`
`'
`6- '1. ~
`2::?. !.-?
`lfi. i
`
`I
`
`<i I
`
`INTERNATIONAL CLASSIFICATION
`'{ !<.
`
`, , /t9-o
`I
`I
`I
`
`c ii"}
`
`PT0270
`(REV. 5-91)
`
`GROUP
`ART UNIT
`
`f6y2-
`
`/vt /tY(I- 77/ /-4
`PRIA~y EXAMINER (PlEAS~T AMP OR PRINT FULL NAME)
`r rvfl.... o /'hi/ (,
`"'o :if./)
`I
`ISSUE CLASSIFICATION sllP
`
`ASSIST ANT EXAMINER (PLEASE ST AMP O~NT FULL NAME)
`
`· A- u /f
`
`U.S. DEPARTMENT OF COMMERCE
`PATENT ANO TRADEMARK.OFFICE
`
`2 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`Best Availabl
`
`Class
`
`i(!J5'
`
`E1·nr.
`
`t}/l
`
`,.
`/ j
`
`I
`
`SEARCHED
`Date
`Sub.
`1tfafa'I
`
`60,{
`G0.::;
`90,21
`1'
`1~t2
`zt/C;/
`z«trJfl
`z'St-J
`JL.()J
`
`~Jb
`
`l1·S.3
`
`)v~bl.
`i;•
`~
`
`1i/1!.t/!5
`
`·\
`&'1~
`
`.:-;,
`
`r?
`------·
`l~-4: ,,:-...-1
`'-fJ,'c ~'I
`l ;-) I
`L\.2:-\
`5Ji!
`\.f y~;
`3~+..3
`y:;v
`._L/:_·~~ . (ic(
`{.r ,;( . l~c,t
`
`/-z..··).,'l?
`s )2:.;!<l'J
`I
`!_! ;/f~o
`I l/t·~/Jt
`
`._,;
`
`C-1,-ft. r , V
`;/-./
`~q_
`
`I
`
`.?
`
`__,,
`(.
`
`'
`.:....,
`·7}.e:>
`
`INTERFERENCE SEARCHED
`Exmr.
`Date
`Sub.
`Class
`'
`s so
`I , /
`4 s ~--·
`
`I
`
`.t;<('T.~ "T' ·d\s·
`j
`
`( 'L i
`( '(. 7
`..,.'/
`,')-c.J
`.
`I
`t( I
`21 _C;
`) ) ) . I
`
`?, .z ~
`
`'(56
`it 2 i./
`4 ::.r
`
`\-<.'
`'
`
`Date
`
`Exmr.
`
`f?A/.
`/1../t6/9t
`- - - - -
`l~_,p: ... --i;;z[)~ ;·71/
`
`L _ _
`
`3 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`·---
`I
`POSiTiON
`I
`•.
`CLASSIFIER
`I
`I EXAMINER
`TYPIST
`VERIFIER
`CORPS CORR.
`SPEC.HAND
`FILEMAINT.
`DRAFTING
`
`Staple ISSl 3 Slip Hf:•e
`
`iDN~.
`
`-----
`
`~~j. .
`
`··I'/
`
`-:>;; ?'!}
`
`DATE
`
`·I ..! ! - ' /
`;;.-/ ..!J/ fl./
`I
`
`I
`
`I
`
`INDEX OF CLAIMS
`
`Date
`
`~ .,
`
`'
`,;;,'
`..:::.
`~ i:
`,.
`
`'::.
`-.
`
`v
`
`I
`!
`I
`
`•
`
`j ~
`
`}--
`
`.:.
`
`Claim
`Ill i
`ii: 5 f,,
`~ c ·c;,
`'i 51
`I 11> 52
`,,
`53
`: z 54
`;l 55
`I[; 56
`- 57
`II 56
`111 59
`!J 60
`Ii 61
`Ii.: 62
`.:., 63
`) ' ~< 64
`l' 65
`
`j I· 66
`Ii 67
`Ill 68
`•'i 69
`i,\ 70
`j .. ~ 71
`: ~l 72
`I 73
`:1. 74
`.::-: 75
`~·;. 76
`;;-' 77
`.:( 78
`.. •/ 79
`:~ 80
`~~' 81
`L ··' 82
`bl 83
`,~ 7. 84
`'' 85
`'"-
`j,, 86
`I'.' 87
`88
`. 7 89
`
`-,,, 91
`/,' 92
`
`·1 94
`,'l 95
`:1. 96 .-:
`I)\ 97 i
`-·1 96 !I
`l~ ':, 3q •
`1·v100 .~
`
`Claim
`Ill
`
`>--
`
`~
`
`,___
`
`.,
`...
`Date
`"
`')} tY.
`"'~ ~ 01. ..
`"~~' ~
`z ..
`'
`'iii :~ ~.~·.
`c
`·~
`,. ~ .'-
`/' (.
`(1'1
`ii:
`" ~,{
`0
`\; 1) ~ \) . ' ' v v
`I
`"
`!
`I
`i
`·!
`!
`'i
`I
`11i'
`j
`,
`,,
`
`,J
`
`I
`
`I
`
`'
`I
`I
`I
`'
`'
`I
`!
`I
`'
`_..-H
`I
`
`v
`v
`..,, v
`
`l/ ..!
`
`v
`
`,.
`I/
`
`v' v
`i
`I
`!
`'
`I
`
`I
`
`v
`v
`t-
`v' >
`I
`!
`
`~
`
`SYMBOLS
`..... Rojec'ed
`Al-.J
`• [Tbrough numbmlt CallClllefi
`+
`.... Restricted
`N ..
`. ............... Noo-elecl!d
`I ..
`.. ............. ". lnteffereOC8
`A ·--
`.. Appeal
`0
`............................. Objecied
`
`--
`
`::
`
`;;:'
`
`-
`
`.-. v
`I
`I
`
`I
`I
`
`I
`
`I
`
`. j
`
`i
`
`i
`I .
`
`·-
`
`()
`
`"'
`
`1
`1
`1
`1
`
`'
`~ 1
`
`'
`
`~
`
`( 1 ·-
`kl
`1
`., I)
`i:l
`at
`21>
`2'
`2
`2
`2l
`30.
`31
`3
`3
`3
`3
`3
`3
`.3
`3
`4•
`41
`4:t
`
`' 43
`
`t
`4ll'
`~ 45
`;_, 46
`47
`
`• 48
`·7 4:J
`' 50
`
`SERIAL NUMBER
`- I ~ •-.
`t '·
`
`! J ~
`
`: . ..
`
`l
`
`)11 I '
`
`•· .. ·
`
`-.~reign priority claimed
`O ·
`'35 USC 119 conditions met D
`'Jerified and Acknowledged -em
`
`. -----·- --·-r---!.!
`
`"'' ''t
`
`• '7
`
`'ARI:;...: f' AP,>'JCATION
`FILED Sf >AfiP''ELY
`
`~TIC~)~ ".!..LOWANCE MAILED
`I
`•
`
`J; I
`
`I
`
`~,.,
`
`'
`
`----·------
`---------
`___ .__....-, ___ ...;.
`II Date "aid
`
`•? }c,1
`
`' •
`
`'
`
`'-···
`
`-i~
`- \.~. ~·:~
`
`7
`
`-;: ..
`
`Label
`Area
`
`orm PT0-436A
`j&v. 8/92i
`
`~:-: ~=.-=-----~-
`<?
`
`(LEFT INSIDE)
`
`4 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`..................... Rcr.~x OF CLA:MS
`
`. Allowed
`(Through numeral) Canceled
`. . ... ...... ..... .. ... . .. .. . . Restricted
`
`I
`A
`0
`
`....... Non-elected
`. lnterterence
`Appeal
`..... Objected
`
`29 1~
`
`..
`
`Claim
`tii c
`a; a
`c
`·c:
`u: 0
`151
`152
`53
`154
`f>5
`156
`!57
`158
`59
`6o
`61
`~
`i;:3
`64
`65
`'66
`167
`1'68
`69
`70
`!71
`72
`173
`74
`75
`76
`'77
`78
`179
`rt>
`81
`82
`'83
`184
`65
`'86
`b7
`88
`b9
`90
`91
`92
`93
`94
`95
`1:16
`97
`98
`99
`I 1,91
`
`Dale
`
`Claim
`
`Date
`
`tii
`£
`
`-
`
`"' "" £8
`
`I
`
`-
`
`-
`
`·- -
`
`--
`
`11{
`11.
`11'
`11•
`1H
`~16
`117
`118
`19
`~10
`111
`112
`113
`114
`115
`116
`117
`118
`119
`~20
`121
`122
`12::
`124
`125
`126
`127
`128
`129
`~~
`131
`1~
`13:
`13'
`11~
`Ila!
`3;
`38
`39
`40
`141
`
`14~
`14<
`14'1
`145
`146
`~47
`
`~4S
`
`14~
`~SC
`
`-- -- .
`
`I
`
`-~
`
`I
`I
`'
`' ·-
`
`·±
`-+
`
`If more than ~ :::;o claims or 1 O actions
`staple additional sheet here
`
`f1 NJ 1 .:.. \
`..
`60
`(i
`6 l
`t~
`
`~
`";:
`=.
`-::..
`)
`-H-v.;..+-~~-f---+--+-~-+--t-1-i
`
`~
`
`I
`
`1 ~
`
`131)
`4 I-.
`
`."' ·~
`::;,
`
`-
`
`ti.,
`t:)~
`u
`I!'>
`6 7
`~6
`P7
`6 'j
`tq
`j18
`•'fv
`19
`'it
`ll10
`·1 z c....:...F:c:.1 • +++-+---/+-+--+--+--+--+--+-~
`;
`'1)
`~,22
`!£/
`;
`23
`71"
`24
`'U
`125
`•1'1
`126
`·11/
`127
`'lJ .....,.i!M..!l!!blv~: -1-...i.-J.-1--1--L-J
`"/,- TiZ9 T
`:
`fl
`30
`ov
`1
`
`::
`
`/
`/
`
`l
`
`-:;
`
`34
`135
`136
`·37
`
`9
`
`41
`112
`
`46
`47
`
`I
`
`5 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`t1ft•.aPCrJPTr· 11uov-··,,.."'
`~
`
`08/1Li620h us
`s·
`tnnex b's~. page I
`.cant's Guide - Volume II - National Chaptc
`~ SS MAIL: BB214759358US
`MAILED:
`17 NOVEMBER 1993
`U.S. DEPAR;:!T~M~EN~;'f~O~F ~CO~M~M~E~RC~E~P~AT~E!!"!t."T~AN~'O~T~RA~D~E~M""!AR~l:~O~F~FIC~E~ATT~OR~N~.EY'~S~DOC~~ .. ET~N~U~M~BE~R;;..;.,;;;;;,;;;,;~..;;,,;;.;.;;.._
`
`PCT
`
`R
`
`-• •
`
`•
`
`fllljU
`FOl<M rro.1 )?0
`(REV 11-9iJ
`
`-- -r
`
`709Pl
`PRIORITY DATE CLAIMED
`14 June 1991 14.06.91
`
`TRANSMITTAL LETTER TO THE UNITED STATES
`DESIGNATED/ELECTED OFFICE (DO/EO/US)
`NTERNATIONAL Al'l'LICATION NO.
`PCT/US92/05126
`TITLE OF INVENTION
`METHOD FOR MAK.ING HUMANIZED ANTIBODIES
`Al'PLICANT(S) FOR DO/EO/US
`Paul J. CARTER Leonard G. PRESTA
`ppli~nt herewith submits to the United States Designated/Elected Office (DO/EO/US) the following items under 35 U.S.C. 371:
`I. CD This express request to immediately begin national examination procedures (35 U.S.C. 37 J (f)).
`2. C!I The U.S. National Fee (35 U.S.C. 37l(c)(l)) and other fees as follows:
`(2) NUMBER FILED
`(3) NUMBER EXTRA
`-20 =
`23
`3
`-3 =
`10
`7
`
`(4) RATE
`x $22.00
`X$74.00
`+ $230.00
`
`(5) CALCULATIONS
`$
`
`518.00
`230.00
`
`'BAsrc NATXONAL FEE (37 CFR 1.492(a)(1)-(5))l
`. 0 For filing with EPO or JPO search report (37CFR I .492{a){5)).....
`0
`
`Intemational preliminary examination fee paid to USPTO (37 CFR 1.482)
`................................................................................................
`S640.00
`No international preliminary examination fee paid to USPTO (37 CFR 1.482)
`but international search fee paid to USPTO {37 CFR I .445(a)(2))..
`$710.00
`
`S830.00
`
`Neither international preliminary examination fee (37 CFR 1.482) nor
`international search fee (37CFR I .445(a)(2)) paid to USPTO.......
`$950.00
`
`International preliminary examination fee paid to USPTO (37 CFR 1.482)
`and all claims satisfied provisions of PCT Articles 33(2)-33(4)...
`$90.00
`
`950.00
`
`Surcharge ofSIJ0.00 for fumishing the National fee or oath or
`0 30 months from the earliest
`declaration later thanO 20
`claimed priority date (37 CFR l .492(e)).
`
`TOTAL OF ABOVE CALCULATIONS
`
`= 1,. 764.00
`
`Affidavit must be filed also.
`
`SUBTOTAL
`D 20 D 30
`
`+
`
`TOTAL NATIONAL FEE $1~764.00
`
`+
`
`40.00
`
`TOTAL FEES ENCLOSED 51,,804.00
`
`a. 0 A check in the amount of S
`to cover the above fees is enclosed.
`b. ~ Please charge my Deposit Accourit No. 07-0630
`in the amount of $ 1, 804. 00
`to cover the above fees.
`A duplicate copy of this sheet is enclosed.
`c. ~ The Commissioner is hereby authorized to c_ha~Jl8Y additional fees which may be required, or credit any
`O/-U-b3 '
`overpayment to Deposit Account No.
`A duplicate copy of this sheet is enclosed.
`
`(January 1993)
`
`6 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`-
`
`Ji"..
`
`I .
`i i\~;i;,. fr\ )ri·
`. US
`Annex U~.VI,,page.2.-. ·
`
`.
`.
`Applicant's Guide - Volume II - National Cl
`
`r- US
`
`.. .
`
`3.
`
`A copy of the International Application as filed (35 U.S.C. 37l(c)(2))
`a. bl is transmitted herewith (required only if not transmitted by the International bureau).
`b. ~ is not required, as the application was filed in the United States receiving Office (RO/US).
`c. D has been transmitted by the International Bureau.
`
`4. D A translation of the International Application into English (35 U.S.C. 37 l(c)(2)).
`
`5.
`
`Amendments to the claims of the International Application under PCT Anicle 19 (35 U.S.C. 371(c){3))
`a D
`are transmitted herewith (required only if not transmitted by the International Bureau).
`b. D
`have been transmitted by the International Bureau.
`
`7.
`
`6. D A translation of the amendments to the claims under PCT Anicle 19 (35 U.S.C. 371(c)(3)).
`IKJ An oath or declaration of the inventor (35 U.S.C. 37l(c)(4)).
`8. D A translation of the annexes to the International Preliminary Examination Report under PCT Article 36
`(35 U.S.C. 371(c)(5)).
`
`Other docwnent(s) or information included:
`9. D An Information Disclosure Statement under 37 CFR 1.97 and 1.98.
`
`10. ~ An assignment document for recording.
`PLEASE MAIL THE RECORQED ASSIGNMENT DOCUMENT TO :
`a. Cl the person whose signature, name and address appears at the bottom of this page.
`b. D
`the following:
`
`11.
`
`e.
`
`The above checked items are being transmited:
`a. 0
`before the eighteenth ( 18) month publication.
`b. D after publication of the Article 20 communication but before twenty (20) months from the priority date.
`c. D after twenty (20) months but before twenty-two (22) months (surcharge and/or processing fee included).
`d. O after twenty-two (22) months (surcharge and /or processing fee included).
`·
`NOTE: Petition to revive (37 CFR l.137(a) or (b)) is necessary ifJS U.S.C. 371 requirements submitted
`after 22 months and NO propel' dema11d for Intematio11al Preliminary Examination was made by 19 months
`from the earliest claimed prioriry date.
`!XI by thirty (30) months and a proper· demand for International Preliminary Examination was made by the 19th
`month from the earliest claimed priority date.
`f. O after thirty (30) months but before thirty-two (32} months and a proper demand for International Preliminary
`Examination was made by the 19th month from the earliest claimed priority date (surcharge and/or processing
`fee included).
`g. D after thirty-two (32) months (surcharge and/or processing fee included).
`NOTE: Petition to revive (37 CFR 1.137(a) or (b)) is necessary if JS U.S.C. 371 requirements submitted
`after 32 months and a proper demand for International Preliminary Examination was made by 19 months
`from the earliest claimed priority date.
`
`12.
`
`\
`
`At the time of transmittal, the time limit for amending claims under Article 19:
`IE has expired and no amendments were made.
`a.
`b. D has not yet expired.
`13. D Certain requirements under 35 U.S.C. 371 were previously submitted by the applicant on ________ _
`namely:
`14_ Submitted herewith arei
`Amendment:
`
`Sequence Diske~t:e, Sequence Listing, Preliminary
`
`Janet: E. Hasak
`NAME
`ADDRESS Genent:ech, Inc
`460 Loint San Bnmo Boulenai;d
`Sout: San Francisco, CA 94080-4990
`REGISTRATION NUMBER
`28,.616
`
`SIONA TURI!
`
`">"'1P10.lJ90(REv 11·92)
`
`Et~l 6 I i.~::
`n Ir{ I I"),.: n.:i-.:.:]
`
`7 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`I
`
`• CERTIFICATION UNDER 37 CFR 1.10
`
`HB214759358US: Express Mail Number
`
`17 NOVEMBER 1993 : Date of Deposit
`
`I hereby certify that this request to initial national processing, including: TRANSMITTAL
`LETTER, PRELIMINARY AMENDMENT, SEQUENCE LISTING & DISKETTE, COMBINED
`DECLARATION & POWER OF ATTORNEY, ASSIGNMENT and COPY OF PRELIMINARY
`EXAMINATION REPORT is being deposited with the United States Postal Service "Express
`Mail Post Office to Addressee" service under 37 CFR 1.10 on the date indicated above and
`is addressed to the Commissioner of Patents and Trademarks, Washington, D.C. 20231.
`
`Carol Koehler
`
`8 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`•
`
`405
`
`H0405
`
`50
`40
`30
`20
`10
`OIVMTQSHKFMSTSVGORVSITCJCASQOVHTAVAWYQQKPGHSPKLLIYSASFRYT
`I
`1111
`I
`I
`I
`11
`111
`1111
`I
`I
`I
`I
`I I
`I l l
`OIQMTQSPSSLSASVGORVTITCRASQOVHTAVAWYQQKPGKAPKLLIYSASFLES
`1111
`I
`I
`1111
`I
`I
`OIQMTQSPSSLSASVGORVTITCRASQOVSSYLAWYQQKPGKAPKLLIYAASSLES
`
`405
`
`H0405
`
`100
`90
`80
`70
`60
`GVPDRFTGNRSGTOFTFTISSVQAEOLAVYYCQQHYTTPPTFGGGTKLEIKRA
`I I I I
`I
`I I
`I
`I
`I
`I
`I I
`I
`I t I I
`I
`I
`I
`I
`GVPSRFSGSRSGTDFTLTISSLQPEOFATYYCQQHYTTPPTFGQGTJCVEIKRT
`I
`1111
`I
`I
`1111
`I
`GVPSRFSGSGSGTOFTLTISSLQPEOFATYYCQQYNSLPYTFGQGTKVEIKRT
`
`9 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`•
`
`•
`
`PCT/US 92105126
`N/14&~&
`
`II
`II
`
`II
`II
`
`I
`I
`
`I
`I
`
`I
`I
`
`I
`I
`
`I
`I
`
`I
`I
`
`II
`II
`
`II
`II
`
`10
`20
`30
`40
`50 A
`EVQLQQSGPELVKPGASLKLSCTASGFNIXDTYIHWVKQRPEQGLEWIGRIYPTN
`EVQLVESGGGLVQPGGSLRLSCAASGFNIKD'l'YIHWVRQAPGKGLEWVARIYPTN
`EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVAVISENG
`---------
`
`Ill 1111
`111 1111
`
`I 1111
`I 1111
`
`v8 -cDa2
`
`60
`70
`80 ABC '·
`90
`100ABC
`GYTRYOPKFQOKATITAOTSSNTAYLQVSRLTSEOTAVYYCSRWGGDGFYAMDYW
`GYTRYAOSVKGRFTISAOTSKNTAYLQMNSLRAEOTAVYYCSRWGGDGFYAMDVW
`SOTYYADSVKGRFTISROOSKNTLYLQMNSLRAEDTAVYYCARDRGGAVSYFOVW
`
`11111111
`11111111
`
`I
`I
`
`I
`I
`
`111 ti
`111 II
`
`II I
`It
`I
`
`I
`I
`
`I
`I
`
`I
`I
`
`I
`I
`
`I
`I
`
`II 111111
`II 111111
`
`'-
`
`.. "'·
`
`t,-"
`
`,
`
`•' :-
`
`405
`
`HU405
`
`405
`
`HU405
`
`HUVHIII
`
`405
`
`HU405
`
`110
`GQGASVTVSS
`I I
`I I
`GQGTLVTVSS
`
`HUVHIII
`
`GQGTLVTVSS
`
`10 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`. .,.
`
`... . .
`
`•
`
`Anneal hu VL or huV8 oligomers to pAKl template
`
`1. Ligate
`2. Isolate assembled oligomers
`3. Anneal to pAKl template (XhoJ-, Stuf+)
`4. Extend and ligate
`
`I
`
`Xhol
`
`1. Transform E. coli
`2. Isolate phagemid pool
`3. Enrich for hu'l and huV8 (Xho I~ Stul-)
`4. ·Sequence verify
`
`pAK2
`
`11 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`~T/US 9 2 I .Q 5 1 2 6
`6f/;~.26,6
`
`100
`
`c: g.g 80
`-
`8 t!
`~'2 o::.
`-e 5 c. 60
`
`~=
`~8
`
`40
`
`I
`
`hu.MAb4DS-1
`
`huMAb4DS-8
`
`muMAb4DS
`
`4
`
`12
`8
`[MAb4D5 variant] µg/ml
`
`16
`
`12 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`If T!US 9 2 I 0 5 1 2 6
`'TT/US 92/0512 6
`' t1?//4'~~
`‘ Jay/4am
`
`'
`
`
`
`--
`
`. . . .-·
`
`13 of 947
`
`Celltrion, |nc., Exhibit 1002
`
`13 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`i' \(";·
`\.
`.._.
`'
`
`!
`
`~ .
`
`1r1us 921os12 6
`o if J Lite, z..o ~
`
`VL
`muxCD3
`huxCD3vl
`huKI
`
`20
`10
`40
`30
`• • • • • •
`DIQMTQTTSSLSASLGDRVTISCRASQDIRNYLNWYQQKP
`**
`*
`*
`DIQMTQSPSSLSASVGDRVTITCRASQDIRNYLNWYQQKP
`# #
`#
`DIQMTQSPSSLSASVGDRVTITCRASQSISNYLAWYQQKP
`
`CDR-Ll
`
`muxCD3
`huxCD3vl
`huKI
`
`60
`50
`80
`70
`••••••
`DGTVKLLIYYTSRLHSGVPSKFSGSGSGTDYSLTISNLEO
`****
`*
`*
`*
`* **
`GKAPKLLIYYTSRLESGVPSRFSGSGSGTDYTLTISSLQP
`## ·#
`#
`GKAPKLLIYAASSLESGVPSRFSGSGSGTDFTLTISSLQP
`
`CDR-L2
`
`muxCD3
`huxCD3vl
`hulCI
`
`90
`100
`•••••••
`EDIATYFCQQGNTLPWTFAGGTKLEIK
`*
`*
`**
`*
`EDFATYYCQQGNTLPWTFGQGTKVEIK
`# #
`EDFATYYCQQYNSLPWTFGQGTKVEIK
`
`CDR-L3
`
`Vs
`muxCD3
`huxCD3vl
`huIII
`
`10
`20
`40
`30
`• • • • •
`EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQS
`**
`**
`*
`* ***
`*
`* *
`EVQLVESGGGLVQPGGSLRLSCAASGYSFTGYTMNWVRQA
`## ## # #
`EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQA
`
`CDR-Hl
`
`a
`50
`60
`70
`•
`• •••••••••
`muxCD3
`HGKNLEWMGLINPYKGVSTYNQKFKDKATLTVDKSSSTAY
`*
`*
`**
`*
`**** ** **
`**
`huxCD3vl PGKGLEWVALINPYKGVTTYADSVKGRFTISVDKSKNTAY
`## #### # #
`# #
`#
`huIII
`PGKGLEWVSVISGDGGSTYYADSVKGRFTISRDNSKNTLY
`
`CDR-H2
`
`muxCD3
`huxCD3vl
`huIII
`
`80 abc
`90
`lOOabcde
`110
`••••••••
`MELLSLTSEDSAVYYCARSGYYGDSDWYFDVWGAGTTVTVSS
`****
`**
`*
`*
`*
`LQMNSLRAEDTAVYYCARSGYYGDSDWYFDVWGQGTLVTVSS
`########### #
`LQMNSLRAEDTAVYYCARGRVGYSLSGLYDYWGQGTLVTVSS
`D E T
`S
`.
`
`CDR-H3
`
`fl<JURt- 5
`
`14 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`'
`
`if ?T!US 9 2 /-0 5 1 2 6
`· o~/14rczorc,
`
`l'XGURB 6A
`
`H52H4-160
`
`pH52-8.0
`
`H52H4-160
`
`pH52-8.0
`
`H52H4-160
`pH52-8.0
`
`H52H4-160
`
`pH52-8.0
`
`H52H4-160
`pHS2-8.0
`
`H52H4-160
`pHS2-8.0
`
`H52H4.-160·
`
`pH52-8.0
`
`10
`20
`30
`QVQLQQSGPELVKPGASVKISCKTSGYTFTE
`·*** ·** **·**·*···** ********
`MGWSCIILFLVATATGVHSEVQLVESGGGLVQPGGSLRLSCATSGYTFTE
`10
`20
`30
`40
`50
`
`40
`50
`60
`70
`80
`YTMHWMKQSHGKSLEWIGGFNPKNGGSSHNQRFMDXATLAVOKSTSTAYM
`******·*· **·***··*·******·********· *··**********
`YTMHWMRQAPGKGLEWVAGINPKNGGTSHNQRFMDRFTISVOKSTSTAYM
`60
`70
`80
`90
`.
`100
`
`90
`100
`110
`120
`130
`ELRSLTSEDSGIYYCARWRGLNYGFDVRYFDVWGAGTTVTVSSASTKGPS
`•• ** ·**···********************** ** ************
`QMNSLRAEDTAVYYCARWRGLNYGFDVRYFDVWGQGTLVTVSSASTKGPS
`110
`120
`130
`140
`150
`
`140
`150
`160
`170
`180
`VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
`****** *·*** ·************************************
`VFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
`160
`170
`180
`190
`200
`
`190
`200
`210
`220
`230
`QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVOKKVEPKSCDKTH
`************** **··***** ***·********** ** * *
`QSSGLYSLSSVVTVTSSNFGTQTYTCNVDHKPSNTKVOKTVERJCCC---v
`210
`220
`230
`240
`
`240
`250
`260
`270
`280
`TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
`*******
`··*************************************·
`ECPPCPAPP-VAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQ
`250
`260
`270
`280
`290
`
`290
`300
`310
`320
`330
`FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
`*******·*************·***·********·***************
`FNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVS
`300
`310
`320
`330
`340
`
`15 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`H52H4-160
`
`pHS2-8.0
`
`H52H4-l60
`
`pHS2-8.0
`
`H52H4-160
`
`pH52-8.0
`
`340
`350
`360
`370
`380
`NKALP!NPIEKTISKAKGQPREPQVYTLPPSREEMT~QVSLTCLVKGFY~-
`* * • * ** * * * * * * * * • * * * ** * • * * * ** * * ** ** ** * * * **** ** * ** * * *
`NKGLPAPIEKTISKTKGQPREPQVYTLPPSREEM'f.'ANQV~LTCLVKGFYP
`350
`360
`370
`390
`38~
`
`400
`390
`410
`420
`430
`SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
`**********************······················~·····
`SDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSR~Q03NVFS
`410
`400
`420
`430
`440
`
`440
`450
`CSVMHEALHNHYTQKSLSLSPGK
`***********************
`CSVMHEALHNHYTQKSLSLSPGK
`450
`460
`
`16 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`l':IGURB IB
`
`H52L6-158
`
`30
`20
`10
`DVQMTQTTSSLSASLGDRVTINCRASQDINN
`*·****· ******·****** *********
`pH52-9.0 MGWSCIILFLVATATGVHSDIQMTQSPSSLSASVGDRVTITCRASQDINN
`20
`30
`40
`50
`10
`
`80
`70
`60
`50
`40
`H52L6-158 YLNWYQQKPNGTVKLLIYYTSTLHSGVPSRFSGSGSGTDYSLTISNLDQE
`*********
`• ***************************·****·*· *
`YLNWYQQKPGKAPKLLIYYTSTLHSGVPSRFSGSGSGTDYTLTISSLQPE
`60
`70
`80
`90
`100
`
`pH52-9.0
`
`130
`120
`110
`100
`90
`H52L6-158 DIATYFCQQGNTLPPTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
`*·***·*******************************************
`DFATYYCQQGNTLPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS
`110
`120
`130
`140
`150
`
`pH52-9.0
`
`180
`170
`160
`150
`140
`H52L6-158 VVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
`**************************************************
`VVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
`160
`170
`180
`190
`200
`
`pHS2-9.0
`
`HS2L6-158
`
`pH52-9.0
`
`·210
`200
`190
`SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
`*********************************
`SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
`210
`220
`230
`
`I
`
`17 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`... J
`
`-,.- ____ ,__ ,, •. ----·-~·. '.""~_ ..
`
`I
`
`IMMUNOGLOBULIN VARIANTS
`
`:5
`
`10
`
`...... " ·.""'.
`
`15
`
`20
`
`25
`
`rr··
`
`30
`
`This invention relates to methods for the preparation and use of variant antibodies and
`application particularly in the fields of immunology and cancer diagnosis and therapy.
`
`Background of the Invention
`
`Naturally occurring antibodies (immunoglobulins) comprise two heavy chains linked
`together by disulfide bonds and two light chains, one light chain being linked to each of the
`heavy chains by disulfide bonds. Each heavy chain has at one end a variable domain (V H)
`followed by a number of constant domains. Each light chain has a variable domain CVL) at one
`end and a constant domain at its other end; the constant domain of the light chain is aligned
`with the first constant domain of the tieavy chain, and the light chain variable domain is
`aligned with the variable domain of the heavy chain. Particular amino acid residues are
`believed to form an interface between the light and heavy chain variable domains, see e.g.
`Chothia et al., J. Mo/. Biol. 186:651-663 ( 1985); Novotny and Haber, Proc. Natl. A cad. Sci.
`USA 82:4592-4596 {1985).
`The constant domains are not involved directly in binding the antibody to an antigen,
`but are involved in various effector functions, such as participation of the antibody in antibody(cid:173)
`dependent cellular cytotoxicity. The variable domains of each pair of light and heavy chains
`are involved directly in binding the antibody to the antigen. The do.mains of natural light and
`heavy chains have the same general structure, and each domain comprises four framework
`(FR} regions, whose sequences are somewhat conserved, connected by three hyper-variable
`or complementarity determining regions CCDRs) (see Kabat, E. A. et al., Sequences of Proteins
`of lf!lmunological Interest, National Institutes of Health, Bethesda, MD, (1987)). The four
`framework regions largely adopt a P-sheet conformation and the CDRs form loops connecting,
`and in some cases forming part of, the P-sheet structure. The CDRs in each chain are held in
`close proximity by the framework regions and, with the CDRs from the other chain, contribute
`
`18 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`'!US 9 21 0 5 l 2 6
`
`s
`
`10
`
`15
`
`20
`
`25
`
`30
`
`to the formation of the antigen binding site.
`Widespread use has been made of monoclonal antibodies, particularly those derived
`from rodents including mice, however they are frequently antigenic in human clinical use. For
`example, a major limitation in the clinical use of rodent monoclonal antibodies is an
`anti-globulin response during therapy (Miller, R. A. et al., Blood 62:988-995 (1983); Schroff,
`R. W. et al., Cancer Res. 45:879-885 (1985)).
`The art has attempted to overcome this problem by constructing "chimeric" antibodies
`in which an animal antigen-binding variable domain is coupled to a human constant domain
`(Cabilly et al., U.S. patent No. 4,816,5-67; Morrison, S. l. et al., Proc. Natl. Acad. Sci. USA
`81:6851-6855 (1984); Boulianne, G. L. eta/., Nature 312:643-646 (1984); Neuberger, M. S.
`et al., Nature 314:268-270 {1985)). The term "chimeric" antibody is used herein to describe
`a polypeptide comprising at least the antigen binding portion of an antibody molecule linked
`to at least part of another protein (typically an immunoglobulin constant domain).
`The isotype of the human constant domain may be selected to tailor the chimeric
`antibody
`for participation
`in ·antibody-dependent cellular cytotoxicity
`(ADCC) and
`complement-dependent cytotoxicity (see e.g. Bruggemann, M. et al., J. Exp. Med.
`166:1351-1361 (1987); Riechmann, L. et al., Nature 332:323-327 (1988); Love et al.,
`Methods in Enzymology 178:515-527 (1989); Bindon et al., J. Exp. Med. 168:127-142
`(1988).
`In the typical embodiment, such chimeric antibodies contain about one third rodent (or
`other non-human species) sequence and thus are capable of eliciting a significant anti-globulin
`response in humans. For example, in the case of the murine anti-CD3 antibody, OKT3, much
`of the resulting anti-globulin response is directed against the variable region rather than the
`constant region (Jeffers, G. J. eta/., Transplantation 41:572-578 (1986)).
`In a further effort to resolve the antigen binding functions of antibodies and to minimize
`the use of heterologous sequences in human antibodies, Winter and colleagues (Jones, P. T.
`et al., Nature 321 :522-525 (1986); Riechmann, L. et al., Nature 332:323-327 (1988);
`Verhoeven, M. et al., Science 239:1534-1536 (1988)) have substituted rodent CDRs or CDR
`sequences for the corresponding segments of a human antibody. As used herein, the term
`"humanized" antibody is an embodiment of chimeric antibodies wherein substantially less than
`an intact human variable domain has been substituted by the corresponding sequence from a
`non-human species. In practice, humanized antibodies are typically human antibodies in which
`some CDR residues and possibly some FR residues are substituted by residues from analogous
`sites in rodent antibodies.
`
`19 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`•
`
`3
`
`i/US 9 2 I 0 5 1 2 6
`
`The therapeutic promise of. this approach is supported by the clinical efficacy of a
`humanized antibody specific for the CAMPA TH-1 antigen with two non-Hodgkin lymphoma
`patients, one of whom had previously developed an anti-globulin response to the parental rat
`antibody (Riechmann, L. et al., Nature 332:323-327 (1988); Hale, G. et al., Lancet
`i: 1394-1399 ( 1988)). A murine antibody to the interleukin 2 receptor has also recently been
`humanized (Queen, C. et al., Proc. Natl. Acad. Sci. USA 86:10029-10033 (1989)) as a
`potential immunosuppressive reagent. Additional references related to humanization of
`antibodies include Co et al., Proc. Natl. Acad. Sci. USA 88:2869-2873 (1991 ); Gorman etal.,
`Proc. Natl. Acad. Sci. USA 88:4181-4185 (1991 ); Daugherty et al., Nucleic Acids Research
`19(9):2471-2476 (1991 ); Brown et al., Proc. Natl. Acad. Sci. USA 88:2663-2667 (1991 );
`Junghans et al., Cancer Research 50: 1495-1502 ( 1990).
`In some cases, substituting CDRs from rodent antibodies for the human CDRs in human
`frameworks is sufficient to transfer high antigen binding affinity (Jones, P. T. et al., Nature
`321 :522-525 (1986); Verhoeven, M. eta/., Science239:1534-1536 (1988)), whereas in other
`cases "it has been necessary to · additionally replace one (Riechmann, L. et al., Nature
`332:323-327
`(1988)) or several
`(Queen, C. et al., Proc. Natl. Acad. Sci. USA
`86:10029-10033 (1989)) framework region (FR} residu~s. See also Co eta/., supra.
`For a given antibody a small number of FR residues are anticipated to be important for
`antigen binding. Firstly for example, certain antibodies have been shown to contain a few FR
`residues which directly contact antigen in crystal structures of antibody-antigen complexes
`(e.g., reviewed in Davies, D. R. et al., Ann. Rev. Biochem. 59:439-473 (1990)). Secondly,
`a number of FR residues have been proposed by Chothia, Lesk and colleagues (Chothia, C. &
`Lesk, A. M., J. Mo/. Biol. 196:$01-917 (1987); Chothia, C. et al., Nature 342:877-883
`(1989); Tramontano, A. et al., J. Mo/. Biol. 215:175-H~2 (1990)) as critically affecting the
`conformation of particular CDRs and thus their contribution to antigen binding. See also
`Margolies eta/., Proc. Natl. Acad. Sci. USA 72:2180-2184 (1975).
`It is also known that, in a few instances, an antibody variable domain (either VH or VL)
`may contain glycosylation sites, and that this glycosylation may improve or abolish antigen
`binding, Pluckthun, Biotechnology 9:545-51 (1991 ); Spiegelberg eta/., Biochemistry 9:4217-
`4223 ( 1970); Wallie et al., J. Exp. Med. 168: 1099-1109 ( 1988); Sox et al., Proc. Natl. A cad.
`Sci. USA 66:975-982 (1970); Margni et al., Ann. Rev. lmmunol. 6:535-554 (1988).
`Ordinarily, however, glycosylation has no influence on the antigen-binding properties of an
`antibody, Pluckthun, supra, (1991 ).
`The three-dimensional structure of immunoglobulin chains has been studied, and crystal
`
`5
`
`10
`
`15
`
`20
`
`25
`
`30
`
`20 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`•
`
`'!US 921 0 5 l 2 6
`
`structures for intact immunoglobulins, for a variety of immunoglobulin fragments, and for
`antibody-antigen complexes have been published (see e.g., Saul et al., Journal of Biological
`Chemistry 25:585-97 (1978); Sheriff eta/., Proc. Natl. Acad. Sci. USA 84:8075-79 (1987);
`Segal et al., Proc. Natl. Acad. Sci. USA 71 :4298-4302 (1974); Epp et al., Biochemistry
`14(22):4943-4952 (1975); Marquart et al., J. Mo/. Biol. 141 :369-391 {1980); Furey et al.,
`J. Mo/. Biol. 167:661-692 (1983); Snow and Amzel, Protein: Structure, Function, and
`Genetics 1 :267-279, Alan R. Liss, Inc. pubs. ( 1986); Chothia and Lesk, J. Mo/. Biol. 196:901-
`917 (1987); Chothia eta/., Nature 342:877-883 (1989); Chothia eta/., Science 233:755-58
`( 1986); Huber et al., Nature 264:415-420 ( 1976); Bruccoleri et al., Nature 335:564-568
`(1988) and Nature 336:266 (1988); Sherman eta/., Journal of Biological Chemistry 263:4064-
`4074 (1988); Amzel and Poljak, Ann. Rev. Biochem. 48:961-67 (1979); Silverton et al., Proc.
`Natl. Acad. Sci. USA 74:5140-5144 (1977); and Gregory et al., Molecular Immunology
`24:821-829 (1987). It is known that the function of an antibody is dependent on its three
`dimensional structure, and that amino acid substitutions can change the three-dimensional
`structure of an antibody, Snow and Amzel, supra.
`It has previously been shown that the
`antigen binding affinity of a humanized antibody can be increased by mutagenesis based upon
`molecular modelling (Riechmann, L. et al., Nature 332:323-327 ( 1988); Queen, C. et al., Proc.
`Natl. Acad. Sci. USA 86:10029-10033 (1989)).
`Humanizing an antibody with retention of high affinity for antigen and other desired
`biological activities is at present difficult to achieve using currently available procedures.
`Methods are needed for rationalizing the selection of sites for substitution in preparing such
`antibodies and thereby increasing the efficiency of antibody humanization.
`The proto-oncogene HER2
`(human epidermal growth factor receptor 2) encodes a
`protein tyrosine kinase (p155HER2) that is related to and somewhat homologous to the human
`epidermal growth factor receptor (see Coussens, L. et al., Science 230: 1132-1139 ( 198 5);
`Yamamoto. T. et al., Nature 319:230-234 (1986); King, C. R. et al., Science 229:974-976
`( 1985))~- HER2 is also known in the field as c-erbB-2, and sometimes by the name of the rat
`homolog, neu. Amplification and/or overexpression of HER2 is associated with multiple human
`malignancies and appears to be integrally involved in progression of 25-30% of human breast
`and ovarian cancers (Slamon, D. J. eta/., Science 235:177-182 (1987), Slamon, D. J. eta/.,
`Science 244: 707-71 2 ( 1 989 >). Furthermore, the extent of amplification is inversely correlated
`with the observed median patient survival time (Slamon, supra, Science 1989).
`The murine monoclonal antibody known as muMAb405 (Fendly, B. M. et al., Cancer
`Res. 50: 1550-1558 ( 1990)), directed against the extracellular domain <ECO) of p 185HER2,
`
`5
`
`10
`
`15
`
`20
`
`25
`
`30
`
`21 of 947
`
`Celltrion, Inc., Exhibit 1002
`
`
`
`•
`
`jCT/US 92/ 0512 6
`
`5
`specifically inhibits the growth of tumor cell lines overexpressing p195HERl in monolayer
`culture or in soft agar {Hudziak, R. M. et al., Molec. Cell. Biol. 9: 1165-1172 ( 1989}; Lupu, R.
`et al., Science 249:1552-1555 (1990)). MuMAb405 also has the potential of enhancing
`tum