throbber
Basic Statistics and
`
`Pharmaceutical
`Statistical
`
`Applications
`
`James E. DE.- Muth
`
`Hill] “In MIMI“;- N'Pc'. 5d]! JIIII
`sum-mm
`cum-n1. 11m awn-MJLC
`
`mjflzaflfiimm
`
`mahnflfluflflnm-uuM-Iuw
`II)?! T II J- 1] £l
`Jinn-mm] 5mmflm-ID.DW1-ITH-1
`inn-ml W IM Hm-IJ “HMS-SW
`mlmmmmmmm m mp1.n-gmh1mu.npnudmwn
`“Mmflmmw Fund: madmnllm PEI-mm
`museummflmmmmmunmmmmmwmlmcummm
`whiwhwmwml Hum-m rmncwndntm-r
`mmdmllmmummmmmmuwm-qlmwmanta-mu.
`rill-child.n'flh¢l min-II
`rIflI'Ir HIP-rum: hut-hit irn't-lfl. Iridium: ill-flwr-l'. “Emil—"lg. Ind
`mall-[Mlnwlnfwuw II'I'IIl'flll'Il'll'llil-I-PIL vim-1 mummm [uh-1H1.
`Fun-plenummflmflfimwmewummlmt¢hmmmmmnfluu
`rmmwmwmlh rmriflfirmflmmllr Wm H: Hale-mid l'lrrw.
`Wmmmmn-mi-mcctuumrmfi ummwmmmwan
`lulu-trim Fvlu'lmlflnulhlhluhlmfllihhlfi luuhyhm_lul1ln
`Iyflmnfplyr—rlhulnnw
`WEN-Huihudxlflmm-mmyhlrflnfilnmmmmmmflmm
`furhflsmndwl-fllnmlwwllfim
`
`Lila-1 lit-alri- mhmm DIM
`
`Clint I-rnnl .m'l‘k I'mm IH Lilli-5' a“:th
`
`informa
`..M'.-a::.+::r::mm :rficafirgmm
`
`Chapman E: HaIUCRC
`mum amp
`Ell-Fl [m mm
`
`cup-ma HII'CIE Inn mun-e
`lwnmmmmm Thi- an.
`
`Hill |I|ll|ll||lll|l|l
`5MPvWH-DWA
`
`Mylan V. MonoSol
`
`M°“°S°1E"'2°18
`
`Page 1
`
`Page 1
`
`Mylan v. MonoSol
`IPR2017-00200
`MonoSol Ex. 2018
`
`

`

`132
`
`all“?
`
`Emmi-nu Emmi: Ind Tel-rim Unit:
`
`133
`
`plun'ng ui' lie rinses. HMWI'. Ill-ere Inn-em in b: u dw-nw'd Ira-Id in the I'M-I'-
`wriglils urlhtlablctsmdlhcupflamrshouldnukn ndjumuhi hymn:
`mm: wailhlwklolhi: luau mun.
`Sim-Him ml. Iflfllfl- Mar Ifl'l'll‘ rllpl In used for control chum.
`lnfltunufl.$cfn5lhuufluntmrplfimtnfidlud udlherflullsmndulln
`will an 111:: annual nhaJL When the null ample i: nulluclnd.
`Ih-i: fin: "In: in
`dmppudmdnmlwisplnnedflmbuhlhmm ill: we] Thispmces:
`mminm. arming imluding I new mm Ind excluding. Ill-r: mlinsl WM
`mmbcrcmunmrd fwlhufluhdlum.1hkyrkhnmiuufnmuldm
`“rpm-ml menu-lg: nfnullipli: mum“: dill
`A “rand rm: ul‘ comm] chili is ill: llllfllli‘fl tum at EUEUM chin-lint
`tuchllqur. II is committed! rmn: sensit'm: 1hl.n Slum cmlml alum: In run-dull
`chmgfi in lh: chm-curiale lining munilnmd {Mm I939. p.
`Th: Cufiuh
`chum an: m cfl'wiivc 'll
`radial Wilts lu mn-nI-wntml
`conditions. Th: nun: CUSUM in from lb: Elicl
`llill mound“: dflillidm I“:
`
`mullile meafiwd rein-memth ltpiwiduanminu. V'wual
`summation oldcvlllm from m Facial-ad harm puinL Thu-t is alliance of
`a mill-cause mailman whim. Ill: cumulll'm: l-m'u ul' Ihc dwinlinm ii animal}!
`large or exit-mi.er small. l-‘urlher lnlhmuiion on CUSUM It.th an be found in
`Mum‘s bout {Mm 1959.».51-70).
`
`PM Esp-hilly Ilifll
`
`Fm nip-hilin is 1mm arm: ham-ml val-“hilly nif- plum ram-iii.“
`any undesirable spa-till m II'III might
`influx-e wrinhilila'.
`It Is the mullm
`viliIbHJ'Iydu-nsulnlj Income-m1: mflmuing il Human-nil nIllII:
`dam In which line prams is meeting “I! numfacturhl raquiremls. II
`in Ill:
`repeatabilin and dummy nl‘ Iluu pun-cm and il- rulllive in In: mum
`“Mun in 'lflTl'l ufspncificn'iun limit: lur'lh-i: product.
`Possible spacial cum of variability include diITan-ni Main site; dlfl'mmt
`:quipmml. Ind diffmnl m running llul cqul'pm-I'm. DnI my in nll'nu'rull
`Ill-use minim illumllncl duauainglkmnpmmranthc mulling;
`mm the Inn: blink of mllailll.
`Eludifl ul' pm umbilin an: dcsigncd In dclu'mlni: wlm lhl: pm ii
`“Glplfllln uf dining undu cmtmllnd cmdifims {mu-Vin; any will mulu lid.-
`Vnriali-ililfl. mm belefil of studying ll'll‘.‘ pm 1:1lein in la Iii-landm- It":
`Inhility urmmwmmmmuramm wimihn m
`spacifimims or by comparing lhe nunnql “liability of I mhle when: 1iiirilli. Ill:
`prom milk-tin: I'I'I'Iitl.
`Pram: cm'bili‘i'y m :11: protein unluum: lint is “in email" wilh the
`spmirxalim limit: by mum-HUM upmle indlnu. Thin imp-rim i: I ruin of
`the din-Mm barium Ill: pm np-ncifinlium [c.lllnd 11!: glacificilian width till fill:
`dc'rinilunofd: mm “Jun. band on six. Irma: slnuhddniltiun units {Ida-rad
`mummwimm.A'upahlapmcm*itd¢finduumluwhkhlllihc
`mum-nu I'III
`imit- lhe madam-finial Epmificu'lun lip-um {Flam Lu}.
`
`Figure 16- llllmuiun of; distilmlinn within “utilization limits.
`
`Capabilily indium: an mall-um mluynd In Flu-u: Eli-i: dim-lamina from n
`lpncifinplwm 'nl [climb-Indrth upwifinlinm. Clplhiliry indinfl I":
`mummfivnmmfimiflhmiumwhk ul'nmclinl
`wwwirmmmnkuwdmhupdmnwldfiMI
`haprnfiniulnillinfld'fl'm‘:
`mmmmmmcrcflwfpmucmflluyindimmmhd
`only n'hunt‘n-u'eisllu'nemple stimuliIIIrlminhmul‘Sflmlap-uinu. 111m
`lhmflhnmnmuiwdlupoimmnthm Iflsmmmhfimfiv:
`alarm-final.
`
`Sevflflnrmbokltundmfheulculujmoilhnwfilmiindlm.Tisthe
`mammafixmmmflislhepmmnuflahlhmaf
`dhpnsiunbundunhlmmiulupnmuilnflwmiuflmedflmmtm
`
`Tim-1m mile wifiuliun limits. The summation mun ll'fl'le difl‘m
`mtmfimfifl.
`
`flier-flirmm mm = U51. — 15!.
`
`Eq. 'i'.li$
`
`mthmflhhm-h-w+3mwlsh-WAsmin
`Ill: pm M, minutely 99.?“- ufllin m undet I l'lfl'I'I-IJ dilfl'lll'llllflll
`mid hwfllillhspluxurrlinwflmflm.mihmh1wfilhililrmipfld
`inmflmfldhawalmflvuiuimufwmh'nfltlysinsigmn.
`C, illtinpln inan Inllln Ihnmnpuhl:
`uflll: mill-uni“
`lin'lilsldlheumlvl'iltm nflhnpmmsinprmudufiulehmlimu
`Mmumawhfluumllq'mmmmqakuIMu
`Tallinn:
`
`Page 2
`
`
`
`Page 2
`
`

`

`131
`
`mum-r r
`
`cm ln'llmll ind Tull-nun min
`
`135
`
`
`
`c.=1.33
`
`q-zm
`
`Figure 1.1 Dilu'ih'uliom [at ruin: C, values.
`
`UflFlfl
`C =—-—----
`ficr
`’
`
`II?
`
`Eq-
`
`Va'ioui C,tci:fluu-cllluumudtn Figlm: 1?. Il'lhc C, islanth
`pranfllufinl'mn tum-and: wiflmflmmdalimifim nmm’del‘w myrtle
`I'mnd.A.CroflmflunuthdimfimiliinulImphlapmm:nulmpd1hnf
`W5Ipufliminur¢gudlm ufwmmmmlsIMMEMm
`MMWEWLEMULHL
`thefl,aquhme.lheptmisJMImfihgsp¢tificlmmdlnhimumur
`0.3%{1m-W.m}derm uiflhdflhdifflepmiimuflumm
`TM:Inuit“:whmupmisjustbuflycqlhlcflhcpmwfliifilrmlflfi
`amthuulh:Wdflwmmllliwhlhewihuiunwidlhjl
`dummflemmemhmuwdlmmimp.kmmm
`:upnmlnlhtuqclvmnl".lfflmlxmmuahjflllflahflyhthclcflmlnlh:
`fiflmliigrdficlrlmmlmnl'mndumiunmmut willnuwdmn-flhcm
`lpuifluflmflmjmlnlhiscue.Ibeprmmbewchedcmb'mflmirym
`illifh Hum the mum leml chum In: :xullul Fur incl mum
`INEQEMMMQMWVMHIEMMWMMM
`Immmldwdcfmnhmighlbeywirlhepmhmtmmautumnal
`
`TIME 14 C, llI"IIIJI=
`
`“Itth writ: Dis:th is}:
`
`M Q Mamba! W
`in
`mm
`2301:
`we
`so
`I331
`151
`15
`um:
`um:
`ms
`m
`I21:
`2.000
`um:
`51}
`
`“hem. Aha. mam behighly hummundnflsludingiflhdu i: an:
`angled Hum I mnuuyd'nm'iblmd populuixm.1"nbll: 1.4
`WafflefncflturnrhnukvnhafflpAlminTnhleTA-fiegrfllfllhecpflfl
`mu lihlyunprwmumhiliw will fill mmmsmifim‘mwm-u
`In: than DEL—HELL Fur :umplt. will: I C, H21} Mm a m dimibulim
`what I2 lilnuwauldfitbumnmlthSLandLSLlIlmmflchlfimlighim
`ilsapadflmimflnflalhcymjghtbclblelndumthltmnmflmhm
`minutorunil‘m
`Somephmfiul mm m
`waflishhiqmdmpmmmbilificsm.fiumflupdmmqmmh
`ICFWIJS [ornipplia'qmlififlfiunllndluwldmimdnfldafln
`ammwimucflmmhwmcmhmm
`mummindimflmufflrififlcmbflwmpmdlmgismflfl
`HIM:
`
`
`. LEE-p p-LSI.
`34F
`'
`3dr
`
`C’,‘ In
`
`E1113
`
`11mm:amuletmumwill»:Win-umaxim-nil:III-apal-aa-thnarn-mlin:rum-1:1:u-rmi:amli‘umlf}.L [h]:
`mmbuawufldhuibudmwinmmd.wcfl maybe
`medmmdnuumeupamdpumm‘dzfocfiwpmdmmshdhrmlhrfi.
`Anulmliwnflhodrutcninufingmcflia:
`
`CF. =c,rJ—u
`
`E4119
`
`whethflmnkddhmbflmlhrmidmhunflhcqmiflufimrmnlnd
`hmmg MI‘VMWnflmm-elwm mmnwmm
`mkflliomhafliflmflmnnfiehukuhlflufiflm
`
`=UEL+LH2
`
`Eq. no
`
`mulmhMMtflh‘mIn-wm
`
`
`Page 3
`
`Page 3
`
`

This document is available on Docket Alarm but you must sign up to view it.


Or .

Accessing this document will incur an additional charge of $.

After purchase, you can access this document again without charge.

Accept $ Charge
throbber

Still Working On It

This document is taking longer than usual to download. This can happen if we need to contact the court directly to obtain the document and their servers are running slowly.

Give it another minute or two to complete, and then try the refresh button.

throbber

A few More Minutes ... Still Working

It can take up to 5 minutes for us to download a document if the court servers are running slowly.

Thank you for your continued patience.

This document could not be displayed.

We could not find this document within its docket. Please go back to the docket page and check the link. If that does not work, go back to the docket and refresh it to pull the newest information.

Your account does not support viewing this document.

You need a Paid Account to view this document. Click here to change your account type.

Your account does not support viewing this document.

Set your membership status to view this document.

With a Docket Alarm membership, you'll get a whole lot more, including:

  • Up-to-date information for this case.
  • Email alerts whenever there is an update.
  • Full text search for other cases.
  • Get email alerts whenever a new case matches your search.

Become a Member

One Moment Please

The filing “” is large (MB) and is being downloaded.

Please refresh this page in a few minutes to see if the filing has been downloaded. The filing will also be emailed to you when the download completes.

Your document is on its way!

If you do not receive the document in five minutes, contact support at support@docketalarm.com.

Sealed Document

We are unable to display this document, it may be under a court ordered seal.

If you have proper credentials to access the file, you may proceed directly to the court's system using your government issued username and password.


Access Government Site

We are redirecting you
to a mobile optimized page.





Document Unreadable or Corrupt

Refresh this Document
Go to the Docket

We are unable to display this document.

Refresh this Document
Go to the Docket