Emgmsm.m
`
`
`
`$meRaga};
`wgmfifi
`
`
`
`\§\\\§\\!\3\\\\
`
`wgmwmmmm
`
`\EQ
`
`4
`
`.MOSES
`
`figmmm
`
`Ummmmmw
`
`$me.m
`
`$3.,
`
`Petitioners Ex. 1009 Page 1
`
`Petitioners Ex. 1009 Page 1
`
`

`

`mwamwmm
`
`Emgggwmg
`
`>033nm33m3mega
`.§mmmgwwmmgmEmgwmgammmxmmx
`
`
`
`mummmmesnmOgmm
` Bo
`
`
`
`mxmmwmmmwgzmwmm
`
`Eb
`
`Petitioners Ex. 1009 Page 2
`
`Petitioners Ex. 1009 Page 2
`
`

`

`
`
`mummgmw«MW\
`
`mum
`
`
`
`
`
`EmMWmWQBcw
`
`\vm.y
`
`
`
`»
`
`.W.«~w:n.\w>n\“wnw“mmmmwwuw“w’ul“‘w!)-“‘vw\:"“
`
`m5
`
`£93
`
`GEEE
`
`@3sz
`
`wmmW
`
`mm:
`
`mamagm
`
`pfiwwW
`
`3mHagan
`
`mgfimnw
`
`fimmmW3§gwmn
`
`.$thNxfivvvflvxn‘ovv.‘“nibnu?«$335t\uvvuEFifi.vfiflfmflvvvtmmmk‘ovvtvmt
`
`“Sm
`
`wmnwmafi
`
`
`
`WW‘mmw@351QOmmwmnfimmamnWoW‘Bme?
`
`33%.5,5“
`
`$me$ch
`
`m8.
`
`
`
`cam”,mm<mw
`
`$333uEWWimvmfi
`
`
`mnmonfimnwfimfiwmflWmm
`
`
`
`mee‘wmaomumommflxWW
`
`
`
`mmmgm.3?”Wm”.
`
`.W
`
`
`
`
`
`<ommmmmExam”gm?ugmmo?Wzmmnmsmm
`
`
`
`
`
`
`
`
`
`nawmwmoramwmmm.5memmahmmnErma
`
`
`
`E‘Ittnuulllilillluu.
`
`
`
`mm”ESngmmamSmmm?Wmamxgwx.<§c3m
`
`
`
`
`
`
`
`
`
`xmmwomamnWarm”x3?Erma“,mgmg?mummlmm
`
`nmwosmmmg”W333a
`Qmagmi
`
`
`
`mcmmqwmmwugammaWSW33,qumemmammamenm,Wmsmmzmm
`
`
`
`
`
`mmmKSoEmmu
`
`
`
`
`
`EmmaSmWEnmmmwmmmmos3&1.QO
`
`mama
`
`E0
`
`mmmmmwmm3Wmfifimm33:33magma?
`
`
`
`
`
`
`
`émmgm$3me3mm“)wmmm
`
`
`
`$.33meammfimwgm
`
`
`
`émfificgWWWfig”.5mm.NEW@33meme
`
`W93mggmfiflwwww.mfiwmxcwfimmam3m“magma,“
`
`gm,
`
`
`am?$33
`
`Wémmnmi.@333
`
`
`
`Was:Emamcsm
`
`WWw
`
`imam?
`
`manafig
`
`”gm“
`
`mfiamm
`
`mmmcmm3m
`
`Emmogmxnm
`
`mmmfiwwfi
`
`_
`
`Petitioners Ex. 1009 Page 3
`
`Petitioners Ex. 1009 Page 3
`
`
`
`
`
`
`

`

` 3%?“
`_._u_
` ‘15....\\m.......wun_.«§_,.:§
`
`
`
`xix»!2!xxssli{2««\§\\§.<.‘.<:‘.............................................:..........\
`
`
`
`
`
`Vwuif
`
`E1323w\\I|p‘l.
`%.\..E+..112figmm
`
`.xiii}m
`..1:51:11
`ma.&mm
`
`
`
`
`
`mwmfifimw&«weNWW“WNWNwNLMNMNN
`
`,.../u/zs.s§$2...3:\za:xxxswiiiiiiiaizk\
`
`3;mmKM..,
`\x
`
`,1
`
`\\\
`
`33me3395m
`
`mfiuhmcfimmfiu
`
`
`
`$.5meE935
`
`3%.15:mm5‘31z
`
`3...»!
`
`rag$mg
`
`mnOmmu
`
`it!
`
`gagfiiiii“wag
`
`§
`nu... ........ “u“..“unu“u“.wuu._““.x..___.__.u
`
`Petitioners Ex. 1009 Page 4
`
`Petitioners Ex. 1009 Page 4
`
`
`
`
`
`

`

`Emgmm
`
`mme
`
`mmm
`
`W3
`
`$3ngm
`
`mm.&mm.mmM»,3mmma.
` \.litilliasli.-~\x-l\R‘1xxlx\xl\\xxx.\~li.‘2:iiiuuiuiiil.{I‘RRiinxuuiiqiqi~1‘I“!~1~\\§.11~1:1~§-~:-~:\1:1\\\:i\l~iiiii~.iit.ilkulupin...“-Itll:{liltgxxxixxigkx‘ii‘ini
`
`’2
`’2,
`g
`E
`E
`gwmwwmwwWWWW,
`
`mam
`
`Petitioners Ex. 1009 Page 5
`
`Petitioners Ex. 1009 Page 5
`
`

`

`mmm§§§§%§§%
`
`
`
`~51.le
`
`
`
`/
`
`\
`
`m@h
`
`gm
`
`mag
`
`Ema““““
`
`
`
`_mm§mmy,
`
`‘\
`
`.,mem
`
`.aEfigmmm
`
`Peti ioners Ex. 1009 Page 6
`
`Petitioners Ex. 1009 Page 6
`
`
`
`
`
`
`

`

`
`
`
`
`\NNNNV\\\\\\\\\\\\\\\\\\\\\\.\\\\\\\\\\\\\\.V
`
`
`
`
`
`\SN.NNNNNN\\\\\\\\\\\\\\\\\\\\\\\\\\\.\.\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\
`
`a1\
`
`WW“‘~“““““““““m‘w.““w.‘.w.“““w. AWN
`
`@memm
`
`k~\\\
`k\
`
`l§§c>xk§§§§§§xl§2t
`
`£5533
`E‘s
`
`mmm
`
`Peti ioners Ex. 1009 Page 7
`
`Petitioners Ex. 1009 Page 7
`
`
`
`
`
`
`

`

`(39
`
`“mm
`
`wmmEm
`
`Nae
`
`“3a
`
`,w‘wa
`
`\
`
`
`
`kwwmwwmm
`
`Petitioners Ex. 1009 Page 8
`
`Petitioners Ex. 1009 Page 8
`
`
`

`

`gmg
`
`mma
`
`mmc
`
`wmo
`
`mmm
`
`WES..
`
`MWJQ..........
`
`....
`
`‘m.
`
`i
`
`w
`
`\\-\\\W\-~\\~\~W\-~£f
`
`\ §r$
`
`s
`
`f.
`
`Peti ioners Ex. 1009 Page 9
`
`
`
`
`
`{.Ru:u:R:uuuiuxuuu-uu-uuuiuus§§ul§~:1::‘liliiil...tut-{iii}:lii::2:~!§11\~~~~~~ii§i.iiiiiiu:.{ll.RE.i!EI.all:gi3x§§§§§§x§§§x§x§§l~§§§§3\
`
`Petitioners Ex. 1009 Page 9
`
`
`
`
`
`
`

`

`Emmwmm
`
`\!.K.K.K.xxxxxxxxxxxxxxxxxxxxxxxxxxsxkslxxxkkss‘ss“{ss‘xxx‘x§»‘\§\\\\3§\%§\\\»\§:\\
`
`wmm
`
`awe
`
`mme
`
`mhe
`
`NKKKKKKKKKKKKKNN
`
`u
`
`..
`
`.
`
`.
`
`.
`
`.
`
`\K
`
`30K.
`
`55;“a.”33
`
`“mm.”3wa “1:“
`
`xmxmfimmm
`
`K..:\\
`
`K.
`
`mam”$3
`
`KKK
`
`Petitioners Ex. 1009 Page 10
`
`Petitioners Ex. 1009 Page 10
`
`
`

`

`Mummwmmawas.ammmmmwmmwwuumuwma—umuuwunuwwwwws
`
`M..M
`
`
`
`M....MmmwM..2m...».main.
`
`.M....._
`
`.
`
`\
`
`
`
`.WMMMM...M....\..M....,EM.M.Mmug...”....CrM..MMMZCMMM.Mafia:M.r...
`
`
`
`
`
`
`
`wmmmM..KO039.C932“
`
`
`
`w.mm;QM”MGM/M3M....Mhm
`
`sect.
`
`§$§<x5§
`
`
`
`
`
`£€§x§<)<\S\\.S.ccxzc>33§53$5§5§§a§~§3§333§333§33§33vx3353§§§$S§€x5
`
`\\.éssi..........w......§....
`
`
`
`
`a......m.,_.§.E.....itm....firgrmwmfi.
`
`
`
`.Edam903WWW
`
`\x\\\\x\\\\\\\\\\\\\\\\\\\\\\\\\.\\\\\\\\\\.\\\\.\x{Mkkx\\\.\.>\\\.»\\\\\\\\(\\\\\\\\$)k
`
`...}:...i....-....RII:-1iii...~......luuu-uuuu....uuuuu..{tutu}:u}i-1}:§:§:§1§~§:::..:..l
`
`...r.......
`
`
`
`
`
`..........”.6an.M
`
`
`
`
`
`
`
`
`
`
`
`>.8.mmmM.....Mm”SENDsigmzfi......»CMAw:r..§.mw,mv.xaw
`
`26.":
`
`_.......................................................................
`
`
`
`
`
`
`
`i...\x..-gumM.m.m.m.¢....£w..Magma.“M.....7.:
`
`mfg.»$53..{M.......-
`
`
`
`
`
`
`
`
`
`
`
`fiOmESmmmmwmvMRMOammm
`
`...“..MSZE.24m...P
`
`TQXMMmmmMGv
`
`
`.../SC5CD3)..wManM.Crumb.
`380%,
`
`.W
`
`
`
`ariamm.
`
`Mone
`
`
`
`
`.wflfigéfifimCm..mm.0cQCUzgw...MmmMumfigxm.
`
`
`fidmmw232%..Eggsmz.2mm§<m.mnum...x0?.mmm
`
`
`
`Mama.
`
`M.....K:2...\w3m§§3§3§3§§\\\‘5‘\«mw.M
`
`“fix.“3:...)\\\.\
`
`
`
`
`
`.....-........................5mm...
`
`we
`
`\\
`
`
`
`M...mfixmTWCZMNmU.MdMufimfimfi.Om...MmUE0“...,
`
`
`
`
`
`
`
`
`
`
`
`3.5.33...mm.mmeOEM.....NQMKM....MH-...M...
`3...CM..MM..M>M,MOM.M.M”C......»
`
`
`\fifiDCMngwMMmO.....OE0:”me...
`
`
`
`HO..\\\806.....MMMMM4.MM.ummUDcmm
`
`urtlt
`
`
`
`
`
`ffwmwmmflzw\xx...
`
`\
`
`MzmMficmM.OM...mmmmMO?@028wmeEm
`
`
`
`
`
`Sits.Sfifisgi‘riSS‘x.S.5i~§§t~SE.SS.<>.§.§§<>$§..S¢>E\E\>5.\s.$>.\\\\.<5.\ssS5.53.355STbiSnb§33§3abSB§KSSS§§S§~§$S
`
`
`
`...MCmmm...EEC.M.PMMM...:.JMNMMMMUMMMTMMH
`
`A
`
`M
`
`MSG.
`
`3mm
`
`Peti ioners Ex. 1009 Page 11
`
`“mm.“m‘nu“.“MM“u“n.u.n“n.u...M“....““...“...“MM.MM“MM.
`
`......z....y\
`YMM.
`.....6
`
`If.
`E
`39mmmwwmehwwwxwwwfiaefi-wméfi-w-méfiwuwwawMumewmewwM
`
`Petitioners Ex. 1009 Page 11
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`

`

`im.
`
`
`xxtfi.1..
`...\%,<§\,.V.}\...::.m..\\.4.::c:345...:.$4,::.2,:.,:,.,.,.§><«{tittlimi55,51:itikiExtikkkmktk:2:53:43:...£425.22...Q..3..ms4?5éi»§tt.\ttl:{\ttt:335153:":::::::.".i..‘..i::i:...........::.:.::.::.:.:.::::::::
`
`
`
`K
`...»...\§.Vm»~
`
`{xitxwfifitfi‘m
`
` .wFa
`
`
`
`
`
`\\\\\\\\\\\\\\\\\\§!\>Ex;vvxsxaxxxxxxxxxsxxxxxxxsxxxxxxxxxsxxxxxxxxtxxx\\\\\\\\\\\\\xxx\\\\\\\\\\\\\xxx!xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx\xxxxxxttxxxxxxxxxxxxxxxxxxxxx}xx\\\\\\\\\\\\\\\\\\\\\\xxx}xxxx}\\\\\\\\\\\\\\\\\\\\\xxxxxxxxx\xxxtxxxxxxxxxx\\\\\\\\\\\\\\xxx\xxxxxxxxxxxxtxtk\{kxxxxxx‘x{\‘xxxxxxxxxxxx‘xxxs‘:l=R1,.
`
`§§§\§§§§§§i\§§§§
`
`
`
`{.§$.¢x..\v.§I¥v$<n$x
`
`Peti ioners Ex. 1009 Page 12
`
`Petitioners Ex. 1009 Page 12
`
`
`

`

`mwmaww33.3
`
`gem
`
`
`
`
`
`3333.33.33.333333,3333$333333
`
`.3333
`
`
`
`333333333333333.3333W333
`
`
`
`33.3333.§§§§§§§§§\§§§\\E5“!»\\\\\\§R§~\§§E§\~\\\\\\\
`
`
`
`
`
` 3.333333%33%3333R3$3333.330333,333.33
`3333333
`
`QMQ
`
`
`
`3333330333333833333333333303.3333
`
`33333333333333.
`
`
`
`03.33.333.3333R3
`
`33.3mm
`
`K§v§§§§§§§§§§§§
`
`3333333333333Nm3o
`
`.333333333
`3\k.‘
`.\MSQA
`E
`
`.xx53.x\xsxs\s\\\\xxxx\\\\\\\\53\§s\\\§..\\\\§--~§s~x\\s\\\\\\\\\\\\\\\\\\\\\.
`
`
`
`Wssx\---\\x--x\\\\\\\\\§<\\\\\\\\x§s§~x\s\\>.\-s~s--~\------------~x-----~x-~§<----------x---------~x--3
`
`fill},
`
`3.35;.my.
`
`\\
`
`fissxx
`
`
`
`733333333.333333333333333
`
`3.3333
`
`. 0333333333333
`
`
`
`
`
`
`
`E.....,.3.33.33.33.33.3333933mm3w...3
`
`s...
`
`33333
`
`
`
`3333333.33,3337333.33.33.333,333.3
`
`33333333335
`
`233.3333
`
`
`
`0338333...33333333303333.
`
`
`
`
`
`.3M33misiimas:
`
`Petitioners Ex. 1009 Page 13
`
`Petitioners Ex. 1009 Page 13
`
`
`
`
`
`
`
`
`
`

`

`«Ax
`
`
`
`
`
`_
`\\.\~.-.‘.\.s\\.
` H.V....‘..v\w.n .
`
`
`
` ox“ _“_
`
`
` mo)“ w “u“ .n) \\\\\ -\\\
`
`Petitioners Ex. 1009 Page 14
`
`Petitioners Ex. 1009 Page 14
`
`

`

`EM
`
`
`
`Petitioners Ex. 1009 Page 15
`
`Petitioners Ex. 1009 Page 15
`
`

`

`“mum
`
`mmmmmmmflm
`
`
`
`mmmjmammmmmafiw
`
`\>\sx§§x§§§§§§s§§§§s§§§§
`
`
`
`iizkkkikikz‘ixzw‘iizisiiiiikiii‘
`
`
`
`
`
`tissssaiittsia!!!i~€§s§s§i§s§§s§s
`
`3?me“my
`
`@mma‘
`
`3mm
`
`
`
` _Q.mmcmmg
`
`fififimmag“
`
`Emacmngmic”,
`
`0mmmammmflm
`mannamm
`
`4mafia
`
`so.mgmgZQX
`
` .flmgaamwmi
`
`@me
`
`330mggmwm
`
`\mwma
`
`
`
`\\\\\\\\\\\\\\\5‘\\\\\\\\\\\§\E§\\MLE
`
`
`..\§§§§V§\§S§fi\\§\§\\\>\\§x\\>\\\\\\x§\\x\\>.<\\\
`
`wmgm‘mfiwwm
`
`0mm,cwmwm23$
`
`tisi‘liisl
`
`23$mm”
`
`fifim
`
`Smwmfimmmem
`
`mmnnamwmmmMum“.
`
`mgmmmmfi
`
`Petitioners Ex. 1009 Page 16
`
`Petitioners Ex. 1009 Page 16
`
`
`
`
`
`

`

`
`
`Emmwm$m
`
`m...
`
`
`
`
`
`wmxmmmmmmwgm\\.....................:.mmg
`
`Petitioners Ex. 1009 Page 17
`
`Petitioners Ex. 1009 Page 17
`
`

`

`JmQQ
`
`Qmmm
`
`mmm
`
`mmmgwflS
`
`mamaii,
`
`mxmmgma
`
`mmM
`
`32mm...”>mom memmyxm
`
`«3%mejgmm
`
`i.
`g
`St
`
`ES!
`
`W
`
`mQ
`
`m§sgiw
`
`AmQQ
`
`Petitioners Ex. 1009 Page 18
`
`Petitioners Ex. 1009 Page 18
`
`
`

`

`‘/
`
`
`
`
`
`
`
`
`
`
`
`{mm\\.\\\,.quxwfimn:f...Em;...
`
`
`:xxxxx\\xxx\\\\xxx\x\\xxx\\\\xxx\\\\Eifikkttktthkztlxii“\,\.\Vii‘ii.3.:i:::::3...3.5:::.:..::....:....:E..l.wowmgmmmmnmyoxa:fixWxfiloiamwmvwmmXNfiuxSammyQ“:..::
`
`
`
`
`
`
`
`
`.1$mm$.30.E»?3%mw.$§3§§$§55..§i:$.
`
`
`
`
`
`mat?wwwmmmomam.ghmwwwmmmagma
`
`
`
`
`
`35233mmgm
`
`
`
`mgfiwxmmmamu6.3moswzm$223
`
`
`
`
`
`“3“.memummfiQmwfixZO
`
`Ocm«Ew53L
`
`m
`
`:2»
`
`
`
`3‘},_ .
`
`a“m
`
`
`
`.an......._
`
`u\~\\~n§EEEK§MEvmmwongfiamarm“
`
`
`m
`
`
`
`,3,amMzwmmpwmmag?..wmWQmzémmmadm?
`
`
`
`w.tE:xkx:§E¥t§3§\§%§_E
`
`”UmmwmmpmomrND.21.1mm.Emmi.wowjzmurézmmm
`
`
`
`
`
`
`
`Magi...
`
`.iiéaszxz:Vi:ES.:.:::E::L
`
`.m..
`
`w...6a”km3gW
`\\X\ v“ “."‘.."""‘.."‘..".."““““““.““““wm“““.\“..N...‘..f
`
`:3zmfiv
`
`
`
`€§§§§§~§§§mfi..........lll..l...!llll
`
`Petitioners Ex. 1009 Page 19
`
`Petitioners Ex. 1009 Page 19
`
`
`
`
`
`
`
`
`
`

`

`......MMMWW‘H“‘.“»~“~w.hm-m~m~WW~x~~WWM..m.un
`
`afisxfigvw‘xiix}!§i-i~€~s~s§lfi§x§x§x§gggiiggs‘x‘xsé
`i~§xx~§§§§§i§§dfifl¥
`
`
`
`23$mxammfigmmnma$3meEzwimmm
`
`
`
`
`
`m,
`
`
`
`\..\
`
`mmg
`
`mmwmmwmnm223flowmmncsam
`
`
`
`033mgwwwmmxmmg:
`
`
`
`mm35mmme333%?
`
`
`
`
`
`mama“.Ammmmmmfi
`
`fivanammnfi
`
`.NmQ\®__________________‘
`
`«mmwwmmm
`
`E
`W“.
`
`
`
`am.”ES:5mmmixm_______
`
`‘........&m@fl
`
`“mg“
`
`Jm©m
`
`43$mgww“
`
`\an"‘-.~§§§ES§R§S§§SEzixtgiti
`\kt‘ixxxkflfisksv‘mmmMW
`h‘m.
`
`.n
`
`Petitioners Ex. 1009 Page 20
`
`Petitioners Ex. 1009 Page 20
`
`
`
`
`

`

`
`
`msoamm44an
`
`mrircé:$3,
`
`
`44444444444444W444WQSE44fi444n44444X4444,,44.344444444444444:
`
`
`,4444444444444444gamuramamN44444444.
`
`
`
`
`
`<0::m<m4.4200me@4543...88
`
`
`
`<0:magma0444444..30480335
`
`
`
`
`
`
`
`34444444444444
`
`Oosmwmimmosmm
`
`.444ch@3444“
`
`Petitioners Ex. 1009 Page 21
`
`Petitioners Ex. 1009 Page 21
`
`
`
`

`

`.\\\\\“iv!!!§\\§!\I¥§\K\\\\\\\\I\\tv.\v.\\§v.\v.\§v.§s....
`
`3&ngmg
`
`..§~E§R§§§§§§§<§3§3§<§§Q\\\swx‘x‘\\\3..\\xre.\Sx§\\\\\§\§§§§\\E\n§§\§x§§§§§§§giifiailé53.53%\EEBEE!
`
`n
`
`
`
`
`
`mwmmmggmmgmmgmmmmwaxg$me
`
`fimmwwaw, \u\§§53333:.:33i}.~§-~u-1xlk§§§i§§§i§§§3§x§
`ammmogg$29 “w.@5333
`§§§i§
`Ogfimfimmmmmg
`
`
`nmnomgmnmmm<m£m
`
`mmfigmmmmmmEmaymmmmm
`
`
`%mmfimwmQEQNBmfiamméfim
`
`
`
`
`
`zmfiagfi$3meSaws“,
`
`SflEmmg
`
`
`
`*9.3mm
`
`$93
`
`Petitioners Ex. 1009 Page 22
`
`Petitioners Ex. 1009 Page 22
`
`
`

`

`3me
`
`Emmx
`
`Em
`
`Jammy
`
`$3
`
`S3“NEWab?33983m333m$ng
`
`
`
`
`
`“lags,tsacccflsccfi.ixxxxxx§§§~x§s§§§n.§~§a§§§§§-§-.\\\\§§i§\\\§i§\\§\.\§!§....\\\
`
`S3mmam£33335mmbgmag
`
`ma3£383mag
`
`$98G3“.er
`
`Emo53“Ema$3
`
`:“mma$3.£933gmgag
`
`,
`
`
`
`\.ExxxgigsxxxkagssxH,.:\xRaR}..-S~§§§i§§i§x§\\\\\\\\§«...\\\§\\§$\\§§S§<\\S¢§§
`
`mms
`
`$33
`
`MiamumwmNQQfigMAmm
`
`
`
`
`
`mmmmwammyfiymmfimmmmammqmwsmmm$QO33
`
`gagmmmmmgm
`
`
`
`
`
`333$memwawmmwmmmmmwmagmaw‘fixmwmmmw
`
`
`
`
`
`Petitioners Ex. 1009 Page 23
`
`
`
`
`
`
`
`.:33i3!«§\\V\\\V\\\\\\\\\\\\\\\\.\xxx\\\\\\\\\\\\~\\xxxxxxxxxxxxxxxxxxxx\\\\\\\\\\\\\\\\\\\\\\\\\\\\§\\\\\\\\\3xstx»§---§--~§~§-§§-§§§R\\\\§\\\\\\\\\\\\\\\\§::
`
`
`
`
`
`Petitioners Ex. 1009 Page 23
`
`
`
`
`
`

`

`m.....M
`
`
`
`
`
`rif:\§§§11}§§1~21}1§1}113111111111311113131113~x}\fx\mt\u.llititmiimtiftliciiitkttit‘ilxtlilzt:13!»NWNMNQm».
`
`
`
`@3wamafia
`
`
`
`mm.“mflag»:mmmmm
`
`mm.(.3..m_“_nm..._“MuMwm”mwmmN*“un..Mnhwm
`53:}...mNMWGS.A}wex«:5a<,9.“w“:~.“Vm.MW,,.5.gamwmm .5....mK...»Mmm..wam“AmMmm._.H.wmmm)I.{m>.mul.>.=).m¥§§x¥im.w_MwNmmMMwMw\§5".{Stitkttfikx
`
`.mmmm“$3.33....iissaizizsiiziasiizszii
`
`
`
`
`{limit-m3.3.immi§ii§m{my-3......tlllilnilillillml.whilmlluiiii
`
`
`
`.3.CC
`
`m.5x
`
`:x
`
`4 i
`
`mM
`
`mW
`
`.3.
`\v.5:
`
`mx
`5i
`
`.%.
`
`E
`
`3‘.55.
`£55.55
`
`55x.:.,ti3).,
`
`El‘iié
`
`:3\‘3‘3x§§§3=3555‘:55:k:5§5:::§3%..
`
`“.“.~.‘...“....»»‘
`
`..
`
`
`
`égsns‘i§ss~§§u~§n§§u
`
`WW.......W‘L...
`3
`
`.
`
`
`
`jisgssiigSxxxsu§§§n§n§§§§E§
`
`~
`
`\\.5N.5»
`
`:
`
`§§x§§§§§§§§§§i
`~\~\\\\\\\\\\\§\\§§xx§<§§§§§<s§
`
`
`
`
`
`
`
`«xx\\\\\\\\\\\\\\\\\\\xxxsxsxxsxsxxxxxxxxx«xxxxxxxxxxsxxxxxxxxx
`
`
`
`i.‘~.x~\.\\Kx\\\xx!‘1lxx\(x~..iliiiin‘l‘iu‘iiil~=-u§\uuuiliiuiiuii~1~l~€§l§§§§l§l“‘53:!luuiiiilii
`
`
`
`
`
`
`
`
`
`\R\\»\\\\3‘\\\\\\\k§>\>\\\\\\\\\\\\~\\\\\\\\\\\\\3\\\\
`
`...“.“.“““».““
`
`.3..iKAv,»\
`
`:5vx.:~<5\,&u.~\{\c
`
`.{xitxxtl
`
`M»..W...-.-.mu...-..5....-...ww...A:-..\\......-..~‘.\\.....w...\.-.-.“x
`"mMm.
`
`mflmmw
`
`Peti ioners Ex. 1009 Page 24
`
`Petitioners Ex. 1009 Page 24
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`

`

`ENQSNN
`
`
`
`
`
`wax:.3.me32mmin.“scamm3“Segugfim
`
`flEfi
`
`ZQMWJR0.24.NEmM»....nJ«MNNmm.........NNN>NPm.»EN0w0mm
`
`
`mmmflmNANNwwuww39NNNNNNQWNBcwSm.3erNM:“warm““www.mwas»?arcNmmwmm3‘m.“.Nmmim:3:1...mum«3@MN5.\\ham«.5N?a.....
`
`
`
`
`
`
`
`
`
`
`
`mmmac.m.....N.am.HNNNhm..NNmm.
`
`"mm“mm.mm.mummmm
`
`
`
`
`mmm(N...,E»wan,a%mm3%,a:Q....»
`
`
`
`zOfiszOQEmLNOhONE.m5mugmgW»33mp.»ANNEMKE3maOmfig
`
`Eng265%mmasm3cNmmma.mmmmm,»awmmNa.3MNNN
`
`§§26ammmm3.mmmmmmflmm3Emmmma»mmmm
`
`
`
`mmmoammfimmmmm“gum$3.“$3..M3.m«mumflea.memmN:wmummcm.«:3fig
`
`
`
`
`
`
`
`
`
`NamNmflmmNNQNNND.mammb
`
`
`
`...nmmfiKmxw3..,
`Na..3EONmmm.m“mmmmm:mmmmmmmmmmmm
`
`
`.zgméodém8Q...53%mmQ0%w.»a?mgEmm.»03.Q3E .mANNNNNE}?.mmmam,NawmmNNCMswcmMambawa.mmmm.»NmNNNJNNwfi
`
`
`INNNmN.Nmwm.“v.r,34m..0fi4§<mSNUiimziwmmWm31w.ANNmfimhm.man,mmm»QRUhQA.WNW.
`
`
`..QM“F..........Pu................m..................0..............Na
`
`mwmfl“....NNNNNNNNNwww.mwmm...Smb2fin
`
`
`
`
`
`
`
`
`AmwmmmeNmmwhhfiwmmwbw.wN1.Nmmmmmmmmmfimwww.mwm
`
`EQMW‘QQNENWHm3E3,N.»“(NEN3
`
`
`
`3:0.“20..mmgmmmmmmmmmm
`
`,wmm.343N
`
`
`
`
`ism.NmmNunQma.«9,.
`
` \\mD0%..Q0%.mMuMaw».
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`
`mmmN390»NW3NNNN.NmNEH?“NSNNC\£\wwmN.mmwmwNmNimN“EmNmmNm«EmmamNNNmmaraw
`
`
`
`
`
`
`
`
`
`
`
`
`
`...:oNmH...§mw:m>wmo\w..:3...ngQN?)
`
`Petitioners Ex. 1009 Page 25
`
`Petitioners Ex. 1009 Page 25
`
`
`
`
`
`
`

`

`
`
`
`
`
`
`wammuEmmammnogmmamz‘wmg9%3mmmwmm3.3&3:mummyMgEgan3m»mm:mmwm33%m3mm?$meawkwaadmmmmS,C
`
`
`
`
`
`
`
`‘._,‘.__................................
`
`WWW—num-An-«-n-n«m~nw\
`
`Ema4%E.Mia
`«.63»gummay”33
`
`
`
`mm»«nah»Ex33a.
`
`m&7d.wNkwMQ
`
`
`
`@3memewgmm‘g
`
`\\
`
`Petitioners Ex. 1009 Page 26
`
`Petitioners Ex. 1009 Page 26
`
`

`

`3.333..
`
`
`
`
`.3.m...33.1,3....333303.3333..1.......003
`
`ooflfihhsnoor§63§v§,.w3...s.....
`
`
`
`
`.33,wm..m§....33...2233.3,333.33...
`
`
`.333.3333
`
`3333wacw
`
`.~
`
`
`
`.._333.333
`
`.333...3..33.”3333..0339333..333.13333.33.
`
`
`
`
`
`.336:3.“.33...3.“«33.2.3.3.
`
`333.3%
`
`thxxlxxxktxxxxx!lxlxkt?»>¢.{.¢Idkxkthiil§t駧§§§1§llxti{l\{.l1x«1\11§}1
`
`
`
`
`
`3333m.333.35..a.....3.313333...:33....m»?.33.
`
`
`
`
`
`Petitioners Ex. 1009 Page 27
`
`Petitioners Ex. 1009 Page 27
`
`
`
`

`

`Electronic Patent Application Fee Transmittal
`
`——
`
`Title of Invention:
`
`A MUSIC INSTRUCTION SYSTEM WITH GAME-LIKE ELEMENTS
`
`
`
`_—
`
`Provisional Filing Fees
`
`Description
`
`Fee Code
`
`Quantity
`
`Sub-Total in
`
`USD($)
`
`Basic Filing:
`
`Miscellaneous-Filing:
`
`Patent-Appeals-and-lnterference:
`
`Post-Al|owance-and-Post-lssuance:
`
`Extension-of—Time:
`
`Petitioners Ex. 1009 Page 28
`
`

`

`Miscellaneous:
`
`Total in USD (5)
`
`-
`
`S b-T t l'
`
`Petitioners Ex. 1009 Page 29
`
`Petitioners Ex. 1009 Page 29
`
`

`

`Electronic Acknowledgement Receipt
`
`Application Number:
`
`International Application Number:
`
`5640897
`
`61222909
`
`Confirmation Number:
`
`6652
`
`Title of Invention:
`
`A MUSIC INSTRUCTION SYSTEM WITH GAME-LIKE ELEMENTS
`
`‘
`
`—
`
`First Named Inventor/Applicant Name:
`
`Customer Number:
`
`Filer Authorized By:
`
`Attorney Docket Number:
`
`Receipt Date:
`
`Filing Date:
`
`Time Stamp:
`
`Application Type:
`
`Payment information:
`
`Submitted with Payment
`
`Payment Type
`
`Payment was successfully received in RAM
`
`RAM confirmation Number
`
`Credlt Card
`
`$110
`
`5713
`
`Deposit Account
`
`Authorized User
`
`File Listing:
`
`Document
`Number
`
`Document Descri
`
`tion
`
`p
`
`Multi
`File Size(Bytes)/
`Part /.zip
`Message Digest
`‘ ‘ i If -'
`X.
`
`
`
`Pages
`(if appl.)
`i i i ‘
`
`Petitioners Ex. 1009 Page 30
`
`

`

`Information:
`
`Information:
`
`Specnflcatlon
`
`.
`.
`07_02_O9_PrOVISIonal_Patent_
`App_2o402.pdf
`
`10212425
`
`71100dae33d2c963997a7f73e48b7c0fd3b
`35357
`
`Miscellaneous Incoming Letter
`
`patent_assign_2jul09.pdf
`
`410342
`
`f6ad0d81fec5fa1c44d20c2218784ed69eb2
`be1
`
`.
`.
`.
`Drawmgs-only black and white lIne
`drawings
`
`.
`.
`07_02_O9_PrOVISIonal_Patent_
`App_Figures_20402.pdf
`
`4547872
`
`983770a3d5fbcdc2fe96cdd0a508f1a62c2a
`6be
`
`
`
`Fee Worksheet (PTO-875)
`
`fee-info.pdf
`
`4b7842ee1e52948b55af06e71a65d193002
`a6392
`
`This Acknowledgement Receipt evidences receipt on the noted date by the USPTO ofthe indicated documents,
`characterized by the applicant, and including page counts, where applicable. It serves as evidence of receipt similar to a
`Post Card, as described in MPEP 503.
`
`New Applications Under 35 U.S.C. 111
`lfa new application is being filed and the application includes the necessary components for a filing date (see 37 CFR
`1.53(b)—(d) and MPEP 506), a Filing Receipt (37 CFR 1.54) will be issued in due course and the date shown on this
`Acknowledgement Receipt will establish the filing date of the application.
`
`National Stage of an International Application under 35 U.S.C. 371
`lfa timely submission to enter the national stage of an international application is compliant with the conditions of 35
`U.S.C. 371 and other applicable requirements a Form PCT/DO/EO/903 indicating acceptance of the application as a
`national stage submission under 35 U.S.C. 371 will be issued in addition to the Filing Receipt, in due course.
`
`New International Application Filed with the USPTO as a Receiving Office
`lfa new international application is being filed and the international application includes the necessary components for
`an international filing date (see PCT Article 11 and MPEP 1810), a Notification of the International Application Number
`and ofthe International Filing Date (Form PCT/RO/105) will be issued in due course, subject to prescriptions concerning
`national security, and the date shown on this Acknowledgement Receipt will establish the international filing date of
`the application.
`
`Petitioners Ex. 1009 Page 31
`
`Petitioners Ex. 1009 Page 31
`
`

`

`Docket No.: 24123520402
`
`IN THE UNITED STATES PATENT AND TRADEMARK OFFICE
`
`) )
`
`) Application No.: Unassigned
`) Filed:
`Unassigned
`) Examiner:
`Unassigned
`) Group An Unit:
`Unassigned~
`)
`)
`
`In re Application of
`
`Harold Lee
`Roger Dannenberg
`
`A MUSIC INSTRUCTION
`For:
`SYSTEM WITH GAME-LlKE
`ELEMENTS
`
`ASSIGNMENT OF APPLICATION AND PATENT RIGHTS FOR UNITED STATES
`PATENT
`
`WHEREAS:
`
`Harold Lee, a US. citizen. residing in Sherman Oaks. California.
`
`Roger Dannenberg. a US. citizen. residing in Pittsburg, Pennsylvania,
`
`hereinafter referred to as ASSIGNORS, have invented and own a certain invention
`
`entitled:
`
`A MUSIC INSTRUCTION SYSTEM WITH GAME-LIKE ELEMNETS
`
`For which the above-referenced application for Letters Patent of the United States has
`
`been executed on the following dates:
`
`Harold Lee
`Roger Dannenberg
`
`I g 22 3
`Date: ? Z
`Date: 7 I
`0
`
`WHEREAS: THE WAY OF H. a California corporation. located at 15155 Camarillo
`
`St. Sherman Oaks. CA 91403 USA. (hereinafter referred to as ASSIGNEE), is desirous of
`
`ERIE AI 07W
`Immmxmmmwmmemmwmummd ourqmacmmh
`
`wanqazpnmE-mLW-emflzumn
`Dammit-1:
`CI fmmsuaamxmnmisdmunmmmc
`Warm
`30 55.145)
`Wh'ifl-Dnlum
`0.... -. "1-.-“... -..- p ~.n‘r.-‘-- ._
`
`Petitioners Ex. 1009 Page 32
`
`Petitioners Ex. 1009 Page 32
`
`

`

`Docket No.2 24123520402
`
`acquiring the entire interest in, to. and under said invention and in. to. and under Letters
`
`Patent or similar legal protection to be obtained therefor in the United States and in any and
`
`all foreign countries.
`
`NOW. THEREFORE, TO ALL WHOM lT MAY CONCERN:
`
`Be it known that in consideration of the payment by ASSIGNEE to ASSIGNORS of
`
`the sum of Ten Dollars ($10.00), the receipt of which is hereby acknowledged. and for other
`
`good consideration. Harold Lee, and Roger Dannenberg hereby sell. assign and transfer
`
`to ASSlGNEE and the successors and assigns of ASSIGNEE the full and exclusive right.
`
`title and interest in and to any invention(s) disclosed in or derived from the above-
`
`referenced patent application. including all such patent applications and patents claiming
`
`priority from the same and further including all title and interest for United States territorial
`
`possessions and for all foreign countries and further including all rights to claim priority. in
`
`and to any and all improvements which are obtained for said invention by said application
`
`or any continuation. continuation-impart. division, renewal. substitute or reissue thereof or
`
`any legal equivalent thereof.
`
`ASSIGNORS hereby covenant
`
`that no assignment.
`
`sale,
`
`agreement or
`
`encumbrance has been or will be made or entered into which would conflict with this
`
`assignment and sale.
`
`ASSIGNORS further covenant that ASSIGNEE will. upon its request. be provided
`
`promptly with all pertinent facts and documents relating to said application, said invention
`
`and said Letters Patent and legal equivalents in foreign countries as may be known and
`
`accessible to ASSIGNORS and will testify as to the same in any interference or litigation
`
`related thereto and will promptly execute and deliver
`
`to ASSIGNEE or
`
`its legal
`
`representative any and all papers. instruments or affidavits required to apply for. obtain.
`
`maintain, issue and enforce said application. said invention and said Letters Patent and
`2
`
`Petitioners Ex. 1009 Page 33
`
`Petitioners Ex. 1009 Page 33
`
`

`

`said equivalents thereof in any foreign country which may be necessary or desirable to
`
`carry out the purposes thereof.
`
`Docket No.: 24123520402
`
`
`
`Petitioners Ex. 1009 Page 34
`
`Petitioners Ex. 1009 Page 34
`
`

`

`Our File No. 24123520402
`
`UNITED STATES PROVISIONAL PATENT APPLICATION FOR
`
`A MUSIC INSTRUCTION SYSTEM WITH GAME-LIKE ELEMENTS
`
`Inventors:
`
`Harold Lcc
`
`Roger Danncnbcrg
`
`Prepared By:
`
`KLEINBERG & LERNER. LLP
`
`I875 Century Park East
`Suite 1150
`
`Los Angeles. CA 90049
`(310) 557-l5]l
`
`Petitioners Ex. 1009 Page 35
`
`Petitioners Ex. 1009 Page 35
`
`

`

`A MUSIC INSTRUCTION SYSTEM WITH GAME-LIKE ELEMENTS
`
`BACKGROUND OI: THE INVENTION
`
`1.
`
`Field of the Invention.
`
`The present invention relates in general to methods and systems for providing a
`
`real-time or near real—time feedback for performing music by way of instructions,
`
`evaluations, and motivating reinforcements in the form of sounds and images. In
`
`particular, this invention relates to such a system and method that can evaluate and score
`
`a user’s performance without an intermediary digital signal processing device between a
`
`musical instrument or human voice and a computing device.
`
`IO
`
`2.
`
`Description of the Related Art.
`
`There is a long history of applying technology to music instruction. See, for
`
`example, Practica Musica by Ars Nova Software, lntonia by Jerry Agin. The Piano Tutor
`
`from Carnegie Mellon University, The SmartMusic system from MakeMusic, Inc., US.
`
`Pat. No. 5,690,496 “Multimedia product for use in a computer for music instruction and
`
`IS
`
`use,” US. Pat. No. 6,390,923 “Music playing game apparatus, performance guiding
`
`image display method, and readable storage medium storing performance guiding image
`
`forming program." However, these and like approaches do not truly capture the
`
`traditional method of learning music. For example, they may not present the sound of an
`
`expert performer of the student’s chosen instrument and they may not offer near real-time
`
`20
`
`feedback as the student performs.
`
`Petitioners Ex. 1009 Page 36
`
`Petitioners Ex. 1009 Page 36
`
`

`

`Traditionally, a music instructor provides feedback in a number of ways both
`
`consciously and subconsciously, such as verbal language, body language, musical
`
`performance, facial expressions, gestures, etc. Therefore, feedback includes both aural
`
`and visual stimuli in real-time. '
`
`Recently, interactive games with musical themes were introduced to bring real-
`
`time feedback to musical performance. See, for example, “Dance, Dance, Revolution,”
`
`Rock Band,” and “Guitar Hero.” In “Dance, Dance Revolution”, users step on floor
`
`sensors in sequence with both music and scrolling representation of dance steps. Users
`
`‘ receive points for accurately timed and placed steps. In the related games “Rock Band”
`
`and “Guitar Hero,” game controllers simulating musical instruments create a simulation
`
`of performing in a rock band. These games also display a scrolling time-line that
`
`indicates whento press buttons and score users on their accuracy of pressing buttons in
`
`time to the music. However, these games use an apparatus or simulated musical
`
`instruments thereby providing feedback to motivate the users to become skillful at
`
`playing the game but provide no meaningful feedback for playing a real musical
`
`instrument.
`
`l0
`
`l5
`
`Further, a recently filed patent application, US. Pat. Application No.
`
`1 ”865,681,
`
`claims a method for evaluating live performance using a musical instrument as an input
`
`device, and not a game controller. However, this invention requires a separate device that
`
`resides outside of the invention to convert instrument live performance so that “live
`
`instrument performance data point has a note and a time tag.” Therefore, users are faced
`
`with buying another intermediary device or special sensors to take advantage of the
`
`invention.
`
`Petitioners Ex. 1009 Page 37
`
`Petitioners Ex. 1009 Page 37
`
`

`

`In addition, as found in prior art, performance cues to assist musical performance
`
`are not necessarily synchronized to a prerecorded expert performance; for example, cues
`
`may simply be part of a MIDI score, where there is no prerecorded~ performance at all.
`
`This non-synchronized situation is commonly implemented in “MIDI files” which
`
`describe a sequence of notes (performance data) in relative terms. Absolute timings are
`
`generated off of the tempo and time signature setting data specified in the MIDI file.
`
`MIDI files are dependent on the sounds contained within and the sound processing power
`
`IO
`
`l5
`
`of the computing device playing back the MIDI file. Therefore, MIDI files not only may
`
`sound different from system to system, they also sound quite different than professional
`
`releases of the same music. Most importantly, MIDI files in and of themselves do not
`
`provide a facility to synchronize to a professionally recorded release nor to react to a
`
`user’s performance. Also in prior art, there may be synchronized performance cues to a
`
`prerecorded expert performance as in some karaoke systems. However the karaoke
`
`system does not allow for evaluation of the user performance based on frequency and
`
`timing dimensions and does not provide real-time feedback on performance accuracy,
`
`which includes dynamically playing or muting the prerecorded expert performance in
`
`accordance with the user’s performance accuracy. However, in contrast to prior art. the
`
`present invention may implement performance cues synchronized to an expert
`
`prerecorded performance of the user’s instructional material.
`
`It can be seen, then, that there is a need in the art for a system and method that can
`
`provide a real-time or near real-time feedback in the form of aural and visual stimuli. It
`
`can also be seen that there is a need in the art for a system and method that evaluates the
`
`user’s performance on the basis of an audio, electrical, optical, radio, Bluetooth(R),
`
`Petitioners Ex. 1009 Page 38
`
`Petitioners Ex. 1009 Page 38
`
`

`

`-5-
`
`Ethernet, or other signal from the musical instrument, eliminating any need for special
`
`game controllers or any extension of a musical instrument with special sensors.
`
`l0
`
`l5
`
`Petitioners Ex. 1009 Page 39
`
`Petitioners Ex. 1009 Page 39
`
`

`

`.5-
`
`SUMMARY OF THE INVENTION
`
`To minimize the limitations in the prior art, and to minimize other limitations that
`
`will become apparent upon reading and understanding the present specification. the
`
`present invention discloses a device that provides real-time or near real-time feedback in
`
`the form of aural and visual stimuli. It can also be seen that there is a need in the art for a
`
`system and method that evaluates the user’s performance on the basis of an audio,
`
`electrical, optical or other signal from the musical instrument, eliminating any need for
`
`special game controllers or any extension ofa musical instrument with special sensors. A .
`
`system in accordance with the present invention comprises a data processing unit for
`
`IO
`
`causing the system to present performance cues for a musical performance, to evaluate
`
`and score a user’s performance with the expected notes, an audio processing unit
`
`connected to the data processing unit for causing audible feedback of the system, a video
`
`display connected to the data processing unit for causing video playback oftlie system.
`
`and a musical instrument that may include the human voice connected to the data
`
`[5
`
`processing unit.
`
`Such a system further comprises means for providing feedback by playing an‘
`
`audio indication, wherein the prerecorded expert performance track of the appropriate
`
`note or set of notes is played when the user performs musical events in the expected
`
`notes; and/or displaying a visual indication of success or failure; and/or providing a score,
`
`wherein a change in score is an indication of how closely the user performs musical
`
`events in the expected notes.
`
`Moreover, such a system further comprises a means for scoring by detecting the
`
`performed musical event, note, notes or musical signal in such a way that performed
`
`Petitioners Ex. 1009 Page 40
`
`Petitioners Ex. 1009 Page 40
`
`

`

`parameters are found, the performed parameters further comprising attributes such as a
`
`set of performed frequencies, a performed note onset time, and a performed note
`
`duration, and by evaluating the accuracy of performed note by comparing the performed
`
`parameters with expected parameters from expected notes, forming a decision as to a
`
`score from the evaluation in response to a level of difficulty and accuracy of performed
`
`musical event, and adding up the score incrementally until the end of the instruction
`
`session.
`
`It is an object of the present invention to provide a system that provides a music
`
`instruction method that encourages students to practice, an essential step in achieving
`
`mastery of an instrument. It is another object of the present invention to provide a game
`
`that people who are not necessarily interested in achieving instrument mastery will still I
`
`want to play, thereby learning the essentials of an instrument incidentally. It is still
`
`another objective of the present invention to provide an interactive music game that is
`
`simply fun to play on its own merits, regardless of music instruction value.
`
`Other features and advantages are inherent in the system and method claimed and
`
`disclosed or will become apparent to those skilled in the art from the following detailed
`
`description and its accompanying drawings.
`
`IO
`
`15
`
`Petitioners Ex. 1009 Page 41
`
`Petitioners Ex. 1009 Page 41
`
`

`

`BRIEF DESCRIPTION OF THE DRAWINGS
`
`Referring now to the drawings in which like reference numbers represent
`
`corresponding parts throughout:
`
`FIG. 1
`
`illustrates the overall system configuration of one embodiment of the invention.
`
`FIG. 2 illustrates the main data for a session.
`
`FIG. 3 shows a schematic layout for the elements of the main interface screen during an
`
`instruction session.
`
`FIG. 4 shows an example of a possible screen display configuration for guitar
`
`instruction.
`
`10
`
`FIG. 5 shows an example of a main instruction session interface with cues for the guitar.
`
`FIG. 6A shows an example of a main instruction session interface showing cues on a
`
`guitar neck as an example of utilizing graphic shapes, sizes, opacity and/or colors to
`
`communicate performance cues for placement, timing, tempo and duration.
`
`FIG. 6B shows an example of how a graphical representation of the user fingering may
`
`IS
`
`enhance performance cues
`
`FIG. 7 shows an example of a main instruction session interface with cues for the voice.
`
`FIG. 8 shows an example of a main instruction session interface with cues for keyboard
`
`instruments.
`
`FIG. 9 shows an example of a main instruction session interface with cues for a drum kit.
`
`Petitioners Ex. 1009 Page 42
`
`Petitioners Ex. 1009 Page 42
`
`

`

`FIG. 10 is a flow chart of the overall instruction session control.
`
`FIG.
`
`1 1 illustrates synchronized performance cues to prerecorded music.
`
`FIG. 12 is a flow chart of the fundamental frequency detection procedure.
`
`FIG. 13 shows a typical audio spectrum from a musical tone.
`
`FIG. 14 shows spectral templates for A3 and C4.
`
`FIG. ISA shows the determination of the best matching note and match score.
`
`FIG. ISB illustrates a method for scoring continuous musical gestures.
`
`FIG. 16 illustrates a method of providing feedback.
`
`FIG. 17 illustrates a method to provide feedback.
`
`FIG. 18 shows an example of a performance statistics screen that summarizes a user’s
`
`particular session.
`
`FIG. 19 shows an example of a rewards session of a virtual store that a user may achieve
`
`by attaining high scores.
`
`FIG. 20 illustrates a method to set overall scoring levels for instruction sessions.
`
`FIG. 21 illustrates a method to report user skill level over time.
`
`FIG. 22 illustrates a method to track skill level by music genre.
`
`Petitioners Ex. 1009 Page 43
`
`Petitioners Ex. 1009 Page 43
`
`

`

`-10-
`
`FIG. 23 illustrates how frequencies are related to note