throbber
Porcine circovirus 2 strain pmws PCV, complete genome
`GenBank: AF027217.1
`FASTA Graphics
`
`
`Go to:
`LOCUS AF027217 1768 bp DNA circular VRL 19-MAR-2009
`DEFINITION Porcine circovirus 2 strain pmws PCV, complete genome.
`ACCESSION AF027217
`VERSION AF027217.1 GI:2689645
`KEYWORDS .
`SOURCE Porcine circovirus 2
` ORGANISM Porcine circovirus 2
` Viruses; ssDNA viruses; Circoviridae; Circovirus.
`REFERENCE 1 (bases 1 to 1768)
` AUTHORS Hamel,A.L., Lin,L.L. and Nayar,G.P.
` TITLE Nucleotide sequence of porcine circovirus associated with
` postweaning multisystemic wasting syndrome in pigs
` JOURNAL J. Virol. 72 (6), 5262-5267 (1998)
` PUBMED 9573301
`REFERENCE 2 (bases 1 to 1768)
` AUTHORS Hamel,A.L., Lin,L.L. and Nayar,G.P.S.
` TITLE Direct Submission
` JOURNAL Submitted (26-SEP-1997) Virology Laboratory, Veterinary Services
` Branch, Manitoba Agriculture, 545 University Crescent, Winnipeg,
` Manitoba R3T 5S6, Canada
`FEATURES Location/Qualifiers
` source 1..1768
` /organism="Porcine circovirus 2"
` /mol_type="genomic DNA"
` /strain="pmws PCV"
` /db_xref="taxon:85708"
` /note="both strands of seven overlapping PCR fragments
` were sequenced; virus isolated from lung, lymph node,
` spleen and tonsil tissue from pigs affected by post
` weaning multisystemic wasting syndrome"
` CDS complement(join(1732..1768,1..92))
` /note="ORF9; predicted 4.6 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59470.1"
` /db_xref="GI:2689654"
` /translation="MWLGSASSILLAGHVAAEVLPRCCRCRSALVILTAHFFRFQL"
` stem_loop join(1746..1768,1..13)
` /function="putative replication site"
` rep_origin join(1762..1768,1..2)
` /note="similar to the nonanucleotide motif in the
` non-pathogenic PCV, GenBank Accession Number U49186"
` CDS 51..995
` /note="ORF1; similar to Rep protein encoded by
` non-pathogenic PCV, GenBank Accession Number U49186;
` predicted 35.8 kDa protein"
` /codon_start=1
` /product="putative Rep protein"
` /protein_id="AAC59462.1"
`
`CEV Exhibit 1012_001
`
`

`

` /db_xref="GI:2689646"
` /translation="MPSKKNGRSGPQPHKRWVFTLNNPSEDERKKIRELPISLFDYFI
` VGEEGNEEGRTPHLQGFANFVKKQTFNKVKWYLGARCYIEKAKGTDQQNKEYCSKEGN
` LLIECGAPRSQGQRSDLSTAVSTLLESGSLVTVAEQHPVTFVRNFRGLAELLKVSGKM
` QKRDWKTNVHVIVGPPGCGKSKWAANFADPETTYWKPPRNKWWDGYHGEEVVVIDDFY
` GWLPWDDLLRLCDRYPLTVETKGGTVPFLARSILITSNQTPLEWYSSTAVPAVEALYR
` RITSLVFWKNATEQSTEEGGQFVTLSPPCPEFPYEINY"
` misc_feature 117..125
` /note="glycosylation site"
` misc_feature 816..824
` /note="glycosylation site"
` misc_feature 906..914
` /note="glycosylation site"
` polyA_signal 327..332
` CDS complement(357..671)
` /note="ORF3; predicted 11.9 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59464.1"
` /db_xref="GI:2689648"
` /translation="MVTIPPLVSRWFPVCGFRVCKISSPFAFTTPRWPHNDVYIGLPI
` TLLHFPAHFQKFSQPAEISDKRYRVLLCNGHQTPALQQGTHSSRQVTPLSLRSRSSTF
` NK"
` CDS complement(386..565)
` /note="ORF4; predicted 6.5 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59465.1"
` /db_xref="GI:2689649"
` /translation="MTCTLVFQSRFCIFPLTFKSSASPRKFLTNVTGCCSATVTRLPL
` SNKVLTAVDRSLRCP"
` misc_feature complement(470..478)
` /note="glycosylation site"
` CDS complement(688..753)
` /note="ORF8; predicted 2.3 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59469.1"
` /db_xref="GI:2689653"
` /translation="MDIDHTVSVDHPTAASHKSHQ"
` polyA_signal 983..988
` CDS complement(989..1033)
` /note="ORF11; predicted 1.8 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59472.1"
` /db_xref="GI:2689656"
` /translation="MKNKNHYEVIKKTQ"
` CDS 1016..1177
` /note="ORF5; predicted 6.2 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59466.1"
` /db_xref="GI:2689650"
` /translation="MVFIFHLGFKWGVFKIKFSELYIHGYTDIVVLVVYTVFERSAEA
` YVVHISRGL"
` polyA_signal complement(1022..1027)
`
`CEV Exhibit 1012_002
`
`

`

` CDS complement(1034..1735)
` /note="ORF2"
` /codon_start=1
` /product="predicted 27.8 kDa protein"
` /protein_id="AAC59463.1"
` /db_xref="GI:2689647"
` /translation="MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGI
` FNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVK
` VEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRY
` FTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMY
` VQFREFNLKDPPLKP"
` misc_feature complement(1301..1309)
` /note="glycosylation site"
` CDS complement(1522..1611)
` /note="ORF6; predicted 3.1 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59467.1"
` /db_xref="GI:2689651"
` /translation="MASSTPASPAPSDILSRLPQSERPPGRWT"
` CDS 1524..1631
` /note="ORF10; predicted 4.1 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59471.1"
` /db_xref="GI:2689655"
` /translation="MSTAQEGVLTVVALTVYPKVRERRVLKMPFFLLQR"
` CDS 1682..1741
` /note="ORF7; predicted 1.9 kDa protein"
` /codon_start=1
` /product="unknown"
` /protein_id="AAC59468.1"
` /db_xref="GI:2689652"
` /translation="MAAGAVSSSAVTPPWIRHS"
`ORIGIN
` 1 accagcgcac ttcggcagcg gcagcacctc ggcagcacct cagcagcaac atgcccagca
` 61 agaagaatgg aagaagcgga ccccaaccac ataaaaggtg ggtgttcacg ctgaataatc
` 121 cttccgaaga cgagcgcaag aaaatacggg agctcccaat ctccctattt gattatttta
` 181 ttgttggcga ggagggtaat gaggaaggac gaacacctca cctccagggg ttcgctaatt
` 241 ttgtgaagaa gcaaactttt aataaagtga agtggtattt gggtgcccgc tgctacatcg
` 301 agaaagccaa aggaactgat cagcagaata aagaatattg cagtaaagaa ggcaacttac
` 361 ttattgaatg tggagctcct cgatctcaag gacaacggag tgacctgtct actgctgtga
` 421 gtaccttgtt ggagagcggg agtctggtga ccgttgcaga gcagcaccct gtaacgtttg
` 481 tcagaaattt ccgcgggctg gctgaacttt tgaaagtgag cgggaaaatg cagaagcgtg
` 541 attggaagac caatgtacac gtcattgtgg ggccacctgg gtgtggtaaa agcaaatggg
` 601 ctgctaattt tgcagacccg gaaaccacat actggaaacc acctagaaac aagtggtggg
` 661 atggttacca tggtgaagaa gtggttgtta ttgatgactt ttatggctgg ctgccgtggg
` 721 atgatctact gagactgtgt gatcgatatc cattgactgt agagactaaa ggtggaactg
` 781 tacctttttt ggcccgcagt attctgatta ccagcaatca gaccccgttg gaatggtact
` 841 cctcaactgc tgtcccagct gtagaagctc tctatcggag gattacttcc ttggtatttt
` 901 ggaagaatgc tacagaacaa tccacggagg aagggggcca gttcgtcacc ctttcccccc
` 961 catgccctga atttccatat gaaataaatt actgagtctt ttttatcact tcgtaatggt
` 1021 ttttattttt catttagggt ttaagtgggg ggtctttaag attaaattct ctgaattgta
` 1081 catacatggt tacacggata ttgtagtcct ggtcgtatat actgttttcg aacgcagtgc
` 1141 cgaggcctac gtggtccaca tttctagagg tttgtagcct cagccaaagc tgagtccttt
` 1201 tgttatttgg ttggaagtaa tcaatagtgg agtcaagaac aggtttgggt gtgaagtaac
` 1261 gggagtggta ggagaagggt tgggggattg tatggcggga ggagtagttt acatatgggt
`
`CEV Exhibit 1012_003
`
`

`

` 1321 cataggttag ggctgtggcc tttgttacaa agttatcatc tagaataaca gcagtggagc
` 1381 ccactcccct atcaccctgg gtgatggggg agcagggcca gaattcaacc ttaacctttc
` 1441 ttattctgta gtattcaaag ggtatagaga ttttgttggt cccccctccc gggggaacaa
` 1501 agtcgtcaat attaaatctc atcatgtcca ccgcccagga gggcgttctg actgtggtag
` 1561 ccttgacagt atatccgaag gtgcgggaga ggcgggtgtt gaagatgcca tttttccttc
` 1621 tccaacggta gcggtggcgg gggtggacga gccaggggcg gcggcggagg atctggccaa
` 1681 gatggctgcg ggggcggtgt cttcttctgc ggtaacgcct ccttggatac gtcatagctg
` 1741 aaaacgaaag aagtgcgctg taagtatt
`//
`
`CEV Exhibit 1012_004
`
`

This document is available on Docket Alarm but you must sign up to view it.


Or .

Accessing this document will incur an additional charge of $.

After purchase, you can access this document again without charge.

Accept $ Charge
throbber

Still Working On It

This document is taking longer than usual to download. This can happen if we need to contact the court directly to obtain the document and their servers are running slowly.

Give it another minute or two to complete, and then try the refresh button.

throbber

A few More Minutes ... Still Working

It can take up to 5 minutes for us to download a document if the court servers are running slowly.

Thank you for your continued patience.

This document could not be displayed.

We could not find this document within its docket. Please go back to the docket page and check the link. If that does not work, go back to the docket and refresh it to pull the newest information.

Your account does not support viewing this document.

You need a Paid Account to view this document. Click here to change your account type.

Your account does not support viewing this document.

Set your membership status to view this document.

With a Docket Alarm membership, you'll get a whole lot more, including:

  • Up-to-date information for this case.
  • Email alerts whenever there is an update.
  • Full text search for other cases.
  • Get email alerts whenever a new case matches your search.

Become a Member

One Moment Please

The filing “” is large (MB) and is being downloaded.

Please refresh this page in a few minutes to see if the filing has been downloaded. The filing will also be emailed to you when the download completes.

Your document is on its way!

If you do not receive the document in five minutes, contact support at support@docketalarm.com.

Sealed Document

We are unable to display this document, it may be under a court ordered seal.

If you have proper credentials to access the file, you may proceed directly to the court's system using your government issued username and password.


Access Government Site

We are redirecting you
to a mobile optimized page.





Document Unreadable or Corrupt

Refresh this Document
Go to the Docket

We are unable to display this document.

Refresh this Document
Go to the Docket