Resources
`Nucleotide
`
`How To
`
`Display Settings:
`
`GenBank
`
`Nucleotide
`Limits Advanced
`
`Sign in to NCBI
`
`Search
`Help
`
`Send:
`
`Change region shown
`
`Homo sapiens BRCA1 (BRCA1) gene, complete cds; ribosomal
`protein L21-like protein (rpL21) pseudogene, complete sequence;
`Rho7 (Rho7) and VatI (VatI) genes, complete cds; and unknown
`(ifp35) gene, exons 1 through 3 and partial cds
`GenBank: L78833.1
`FASTA Graphics
`
`Go to:
`
`LOCUS L78833 117143 bp DNA linear PRI 12-OCT-2005
`DEFINITION Homo sapiens BRCA1 (BRCA1) gene, complete cds; ribosomal protein
` L21-like protein (rpL21) pseudogene, complete sequence; Rho7 (Rho7)
` and VatI (VatI) genes, complete cds; and unknown (ifp35) gene,
` exons 1 through 3 and partial cds.
`ACCESSION L78833
`VERSION L78833.1 GI:1698398
`KEYWORDS .
`SOURCE Homo sapiens (human)
` ORGANISM Homo sapiens
` Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
` Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
` Catarrhini; Hominidae; Homo.
`REFERENCE 1 (bases 1 to 117143)
` AUTHORS Smith,T.M., Lee,M.K., Szabo,C.I., Jerome,N., McEuen,M., Taylor,M.,
` Hood,L. and King,M.C.
` TITLE Complete genomic sequence and analysis of 117 kb of human DNA
` containing the gene BRCA1
` JOURNAL Genome Res. 6 (11), 1029-1049 (1996)
` PUBMED 8938427
`COMMENT GSDB:S:76287.
` Characterization of an aberrant BRCA1 cDNA clone in the original
` report (Miki, 1994) led to the misidentification of an inserted Alu
` element as exon 4. Not normally found in BRCA1 transcripts,
` insertion of this Alu would lead to introduction of a STOP codon.
` Hence, BRCA1 exons and introns are numbered 1a, 1b, 2, 3, 5, 6,
` etc.
`FEATURES Location/Qualifiers
` source 1..117143
` /organism="Homo sapiens"
` /mol_type="genomic DNA"
` /db_xref="taxon:9606"
` /map="17q21"
` /clone_lib="Los Alamos chromosome 17 specific cosmid
` library"
` /germline
` repeat_region complement(222..2071)
` /note="putative"
` /rpt_family="pTR5"
` repeat_region complement(692..992)
` /note="putative"
` /rpt_family="AluY"
` gene 3344..84436
` /gene="BRCA1"
` exon 3344..3464
` /gene="BRCA1"
` /note="exon 1a; putative"
` /number=1
` intron 3465..4619
` /gene="BRCA1"
` /note="intron 1a; putative"
`
`Customize view
`Basic Features
` Default features
` Gene, RNA, and CDS features
`only
`Features added by NCBI
` 13 conserved domains
`Display options
` Show sequence
` Show reverse complement
`
`Update View
`
`Analyze this sequence
`Run BLAST
`Pick Primers
`Highlight Sequence Features
`Find in this Sequence
`
`LinkOut to external resources
`Order full-length cDNA clone
`[PlasmID Repository at Harvard...]
`
`Related information
`Related Sequences
`Full text in PMC
`Gene
`Gene Genotype
`GeneView in dbSNP
`Map Viewer
`OMIM
`Protein
`PubMed
`PubMed (Weighted)
`Taxonomy
`
`Recent activity
`
`Turn Off
`Clear
`smith brca1 1996 genomic dna
`(13)
`Nucleotide
`Homo sapiens BRCA1 (BRCA1)
`gene, complete cds; ribosomalNucleotide
`smith brca1 1996 (27)
`
`Nucleotide
`
`smith brca1 (2079)
`
`GeneDX 1031, pg. 1
`
`

`

`Nucleotide
`
`See more...
`
` /number=1
` exon 3621..3998
` /gene="BRCA1"
` /note="exon 1b; putative"
` /number=1
` /db_xref="GDB:126611"
` repeat_region 3746..3977
` /note="putative"
` /rpt_family="AluSg"
` repeat_region 3958..3987
` /note="putative"
` /rpt_unit_seq="(caaaa)x6"
` intron 3999..4619
` /gene="BRCA1"
` /note="intron 1b; putative"
` /number=1
` repeat_region 4588..4599
` /note="putative"
` /rpt_unit_seq="(at)x6"
` exon 4620..4718
` /gene="BRCA1"
` /note="putative"
` /number=2
` CDS join(4639..4718,12955..13008,22201..22278,23778..23866,
` 24473..24612,28853..28958,31443..31488,32810..32886,
` 33872..37297,37700..37788,46156..46327,52118..52244,
` 54211..54401,57494..57804,61038..61125,64782..64859,
` 65360..65400,71598..71681,77620..77674,79543..79616,
` 81034..81094,82936..83060)
` /gene="BRCA1"
` /experiment="experimental evidence, no additional details
` recorded"
` /codon_start=1
` /product="BRCA1"
` /protein_id="AAC37594.1"
` /db_xref="GI:1698399"
` /translation="MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFC
` KFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYA
` NSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLG
` TVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISL
` DSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGT
` NTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTP
` STEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDEL
` LGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSK
` SVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRP
` TSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEK
` NPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALE
` LVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSN
` KPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKV
` SNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEP
` NKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQY
` LQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNE
` SNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHG
` LLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNN
` IRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGV
` LQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVC
` SETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRR
` GAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLS
` LKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGS
` SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSV
` SEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDS
` SALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVE
` RSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSY
` LPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAES
` AQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKF
` ARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKER
` KMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMV
` QLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSV
` ALYQCQELDTYLIPQIPHSHY"
` misc_feature join(4705..4718,12955..13008,22201..22270)
` /gene="BRCA1"
` /note="RING-finger (Really Interesting New Gene) domain, a
` specialized type of Zn-finger of 40 to 60 residues that
` binds two atoms of zinc; defined by the 'cross-brace'
` motif C-X2-C-X(9-39)-C-X(1-3)-
`
`GeneDX 1031, pg. 2
`
`

`

` H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably...; Region:
` RING; cd00162"
` /db_xref="CDD:238093"
` misc_feature join(57766..57804,61038..61125,64782..64859,65360..65379)
` /gene="BRCA1"
` /note="Breast Cancer Suppressor Protein (BRCA1),
` carboxy-terminal domain. The BRCT domain is found within
` many DNA damage repair and cell cycle checkpoint proteins.
` The unique diversity of this domain superfamily allows
` BRCT modules to interact forming homo...; Region: BRCT;
` cd00027"
` /db_xref="CDD:237994"
` misc_feature join(77629..77674,79543..79616,81034..81094,82936..82994)
` /gene="BRCA1"
` /note="Breast Cancer Suppressor Protein (BRCA1),
` carboxy-terminal domain. The BRCT domain is found within
` many DNA damage repair and cell cycle checkpoint proteins.
` The unique diversity of this domain superfamily allows
` BRCT modules to interact forming homo...; Region: BRCT;
` cd00027"
` /db_xref="CDD:237994"
` misc_feature 35143..36135
` /gene="BRCA1"
` /note="Ethylene insensitive 3; Region: EIN3; pfam04873"
` /db_xref="CDD:252847"
` misc_feature 34231..34722
` /gene="BRCA1"
` /note="Serine-rich domain associated with BRCT; Region:
` BRCT_assoc; pfam12820"
` /db_xref="CDD:193295"
` misc_feature order(4708..4710,4717..4718,12955,12989..12991,
` 12995..12997,13004..13006,22205..22207,22247..22249,
` 22256..22258)
` /gene="BRCA1"
` /note="cross-brace motif; other site"
` /db_xref="CDD:238093"
` misc_feature order(61038..61040,61050..61052,61059..61061,61068..61070,
` 61074..61076)
` /gene="BRCA1"
` /note="Dimer interface [polypeptide binding]; other site"
` /db_xref="CDD:237994"
` misc_feature order(64859,65360..65361,65371..65373)
` /gene="BRCA1"
` /note="BRCT sequence motif; other site"
` /db_xref="CDD:237994"
` misc_feature order(77674,79543..79544,79554..79556,79563..79565,
` 79572..79574,79578..79580)
` /gene="BRCA1"
` /note="Dimer interface [polypeptide binding]; other site"
` /db_xref="CDD:237994"
` misc_feature order(82977..82979,82989..82991)
` /gene="BRCA1"
` /note="BRCT sequence motif; other site"
` /db_xref="CDD:237994"
` intron 4719..12954
` /gene="BRCA1"
` /note="putative"
` /number=2
` repeat_region 5088..5380
` /note="putative"
` /rpt_family="AluSc"
` repeat_region complement(5500..5661)
` /note="putative"
` /rpt_family="AluJb"
` repeat_region complement(5662..5970)
` /note="putative"
` /rpt_family="AluY"
` repeat_region complement(5971..6109)
` /note="putative"
` /rpt_family="AluSq"
` repeat_region 6131..6395
` /note="putative"
` /rpt_family="MIR2"
` repeat_region 6396..6409
` /note="putative"
`
`GeneDX 1031, pg. 3
`
`

`

` /rpt_unit_seq="(taaac)x2"
` repeat_region complement(7032..7330)
` /note="putative"
` /rpt_family="AluSp"
` repeat_region 7334..7357
` /note="putative"
` /rpt_unit_seq="(ttttg)x4"
` repeat_region complement(7341..7641)
` /note="putative"
` /rpt_family="AluY"
` repeat_region complement(7648..7940)
` /note="putative"
` /rpt_family="AluSg"
` repeat_region complement(7951..8251)
` /note="putative"
` /rpt_family="AluY"
` repeat_region complement(9450..9549)
` /note="putative"
` /rpt_family="AluFLAM_C"
` repeat_region 9693..9973
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 9999..10356
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 10367..10806
` /note="putative"
` /rpt_family="MIR2"
` repeat_region 10797..10852
` /note="putative"
` /rpt_family="MIR2"
` repeat_region complement(10984..11275)
` /note="putative"
` /rpt_family="AluSg"
` repeat_region complement(11276..11575)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 11650..11732
` /note="putative"
` /rpt_family="MER42c"
` repeat_region 11917..12211
` /note="putative"
` /rpt_family="AluSq"
` repeat_region 12223..12370
` /note="putative"
` /rpt_family="AluJo"
` exon 12955..13008
` /gene="BRCA1"
` /note="putative"
` /number=3
` intron 13009..22200
` /gene="BRCA1"
` /note="putative"
` /number=3
` repeat_region complement(13213..13511)
` /note="putative"
` /rpt_family="AluSg"
` repeat_region 14274..14343
` /note="putative"
` /rpt_family="AluFRAM"
` repeat_region 14503..14644
` /note="putative"
` /rpt_family="AluJo"
` repeat_region complement(14645..14932)
` /note="putative"
` /rpt_family="AluSq"
` repeat_region 15068..15368
` /note="putative"
` /rpt_family="AluSc"
` repeat_region 15353..15371
` /note="putative"
` /rpt_unit_seq="(aaaag)x3"
` repeat_region 15632..15932
` /note="putative"
` /rpt_family="AluSp"
`
`GeneDX 1031, pg. 4
`
`

`

` repeat_region 16085..16096
` /note="putative"
` /rpt_unit_seq="(tg)x6"
` repeat_region complement(16108..16295)
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 16350..16639
` /note="putative"
` /rpt_family="AluSg"
` repeat_region 16874..16896
` /note="putative"
` /rpt_unit_seq="(tttg)x5"
` repeat_region complement(16894..17193)
` /note="putative"
` /rpt_family="AluY"
` repeat_region 16900..16913
` /note="putative"
` /rpt_unit_seq="(tttgt)x2"
` repeat_region complement(17196..17496)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 17201..17215
` /note="putative"
` /rpt_unit_seq="(ttttg)x3"
` repeat_region complement(17618..17915)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region complement(17921..18041)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region complement(18071..18129)
` /note="putative"
` /rpt_family="MER33"
` repeat_region complement(18130..18429)
` /note="putative"
` /rpt_family="AluJb"
` repeat_region 18541..18837
` /note="putative"
` /rpt_family="AluY"
` repeat_region 19438..19664
` /note="putative"
` /rpt_family="AluJb"
` repeat_region 19716..19739
` /note="putative"
` /rpt_unit_seq="(ttttg)x4"
` repeat_region complement(19721..20001)
` /note="putative"
` /rpt_family="AluSp"
` repeat_region complement(20008..20305)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region complement(20385..20671)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 20524..20535
` /note="putative"
` /rpt_unit_seq="(cac)x4"
` repeat_region 20807..20881
` /note="putative"
` /rpt_family="MIR2"
` repeat_region complement(20924..21029)
` /note="putative"
` /rpt_family="L1"
` repeat_region 21067..21351
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 21372..21671
` /note="putative"
` /rpt_family="AluY"
` repeat_region complement(21690..21817)
` /note="putative"
` /rpt_family="L1"
` repeat_region 22176..22189
` /note="putative"
` /rpt_unit_seq="(ttct)x3"
`
`GeneDX 1031, pg. 5
`
`

`

` exon 22201..22278
` /gene="BRCA1"
` /note="putative"
` /number=5
` intron 22279..23777
` /gene="BRCA1"
` /note="putative"
` /number=5
` repeat_region complement(22596..22869)
` /note="putative"
` /rpt_family="AluJb"
` repeat_region 22907..23037
` /note="putative"
` /rpt_family="MIR2"
` repeat_region 23195..23496
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 23318..23333
` /note="putative"
` /rpt_unit_seq="(aaat)x4"
` exon 23778..23866
` /gene="BRCA1"
` /note="putative"
` /number=6
` intron 23867..24472
` /gene="BRCA1"
` /note="putative"
` /number=6
` exon 24473..24612
` /gene="BRCA1"
` /note="putative"
` /number=7
` intron 24613..28852
` /gene="BRCA1"
` /note="putative"
` /number=7
` repeat_region 24628..24650
` /note="putative"
` /rpt_unit_seq="(ttc)x7"
` repeat_region complement(24657..24909)
` /note="putative"
` /rpt_family="AluJo"
` repeat_region complement(24709..24909)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 25115..25221
` /note="putative"
` /rpt_family="AluFLAM_A"
` repeat_region 25135..25243
` /note="putative"
` /rpt_family="SVA"
` repeat_region complement(25248..25549)
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 25665..25786
` /note="putative"
` /rpt_family="AluFLAM_C"
` repeat_region 25790..26078
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 26081..26377
` /note="putative"
` /rpt_family="AluSc"
` repeat_region 26381..26664
` /note="putative"
` /rpt_family="AluY"
` repeat_region 26666..26827
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 26934..27229
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 27242..27540
` /note="putative"
` /rpt_family="AluSg"
`
`GeneDX 1031, pg. 6
`
`

`

` repeat_region 27705..27996
` /note="putative"
` /rpt_family="AluSx"
` repeat_region complement(28013..28033)
` /note="putative"
` /rpt_family="AluY"
` repeat_region 28033..28075
` /note="putative"
` /rpt_unit_seq="(at)x21"
` repeat_region 28089..28099
` /note="putative"
` /rpt_unit_seq="(ta)x5"
` repeat_region 28126..28174
` /note="putative"
` /rpt_unit_seq="(ta)x24"
` repeat_region 28175..28188
` /note="putative"
` /rpt_unit_seq="(ca)x7"
` repeat_region 28197..28208
` /note="putative"
` /rpt_unit_seq="(ta)x6"
` repeat_region 28209..28222
` /note="putative"
` /rpt_unit_seq="(ca)x7"
` repeat_region 28216..28394
` /note="putative"
` /rpt_family="AluSx"
` repeat_region complement(28561..28685)
` /note="putative"
` /rpt_family="AluJo"
` exon 28853..28958
` /gene="BRCA1"
` /note="putative"
` /number=8
` intron 28959..31442
` /gene="BRCA1"
` /note="putative"
` /number=8
` repeat_region 29163..29465
` /note="putative"
` /rpt_family="AluSp"
` repeat_region 29612..29914
` /note="putative"
` /rpt_family="AluSp"
` repeat_region 29925..30042
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 30067..30368
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 30426..30703
` /note="putative"
` /rpt_family="AluJo"
` repeat_region complement(30886..31117)
` /note="putative"
` /rpt_family="MIR"
` repeat_region complement(31130..31260)
` /note="putative"
` /rpt_family="AluSq"
` repeat_region 31307..31357
` /note="putative"
` /rpt_family="MIR2"
` exon 31443..31488
` /gene="BRCA1"
` /note="putative"
` /number=9
` intron 31489..32809
` /gene="BRCA1"
` /note="putative"
` /number=9
` repeat_region complement(31577..31755)
` /note="putative"
` /rpt_family="L1PA15"
` repeat_region complement(32142..32311)
` /note="putative"
`
`GeneDX 1031, pg. 7
`
`

`

` /rpt_family="AluSc"
` repeat_region 32322..32334
` /note="putative"
` /rpt_unit_seq="(tttc)x3"
` repeat_region complement(32336..32636)
` /note="putative"
` /rpt_family="AluSx"
` exon 32810..32886
` /gene="BRCA1"
` /note="putative"
` /number=10
` intron 32887..33871
` /gene="BRCA1"
` /note="putative"
` /number=10
` repeat_region 33126..33144
` /note="putative"
` /rpt_unit_seq="(tttg)x4"
` repeat_region complement(33131..33432)
` /note="putative"
` /rpt_family="AluJb"
` exon 33872..37297
` /gene="BRCA1"
` /note="putative"
` /number=11
` intron 37298..37699
` /gene="BRCA1"
` /note="putative"
` /number=11
` exon 37700..37788
` /gene="BRCA1"
` /note="putative"
` /number=12
` intron 37789..46155
` /gene="BRCA1"
` /note="putative"
` /number=12
` repeat_region 37798..37810
` /note="putative"
` /rpt_unit_seq="(gt)x6"
` repeat_region 37903..38058
` /note="putative"
` /rpt_family="MIR2"
` repeat_region 38083..38359
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 38343..38357
` /note="putative"
` /rpt_unit_seq="(aaac)x3"
` repeat_region complement(38445..38528)
` /note="putative"
` /rpt_family="MIR"
` repeat_region complement(38702..39003)
` /note="putative"
` /rpt_family="AluJb"
` repeat_region 39059..39185
` /note="putative"
` /rpt_family="AluSq"
` repeat_region complement(39398..39700)
` /note="putative"
` /rpt_family="AluSq"
` repeat_region 40124..40287
` /note="putative"
` /rpt_family="SUB_L1-S"
` repeat_region 40191..40294
` /note="putative"
` /rpt_family="L1MB4"
` repeat_region 40297..40347
` /note="putative"
` /rpt_family="MER60B"
` repeat_region 40357..40578
` /note="putative"
` /rpt_family="L1MB4"
` repeat_region 40681..40990
` /note="putative"
`
`GeneDX 1031, pg. 8
`
`

`

` /rpt_family="AluJo"
` repeat_region complement(41050..41350)
` /note="putative"
` /rpt_family="AluSp"
` repeat_region complement(42397..42440)
` /note="putative"
` /rpt_family="MIR2"
` repeat_region 42583..42621
` /note="putative"
` /rpt_unit_seq="(tg)x19"
` repeat_region 42877..42887
` /note="putative"
` /rpt_unit_seq="(ta)x5"
` repeat_region 43351..43364
` /note="putative"
` /rpt_unit_seq="(ttttc)x2"
` repeat_region complement(43352..43473)
` /note="putative"
` /rpt_family="AluSg"
` repeat_region 44267..44401
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 44402..44699
` /note="putative"
` /rpt_family="AluY"
` repeat_region 44700..44868
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 44854..44868
` /note="putative"
` /rpt_unit_seq="(aaat)x3"
` repeat_region 45149..45199
` /note="putative"
` /rpt_family="MIR2"
` repeat_region 45276..45562
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 45550..45568
` /note="putative"
` /rpt_unit_seq="(aaag)x4"
` exon 46156..46327
` /gene="BRCA1"
` /note="putative"
` /number=13
` intron 46328..52117
` /gene="BRCA1"
` /note="putative"
` /number=13
` repeat_region complement(47828..47912)
` /note="putative"
` /rpt_family="AluSq"
` repeat_region complement(47927..48208)
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 48236..48415
` /note="putative"
` /rpt_family="AluSp"
` gene complement(48899..49390)
` /gene="rpL21"
` CDS complement(48899..49390)
` /gene="rpL21"
` /experiment="experimental evidence, no additional details
` recorded"
` /note="ribosomal protein L21-like protein"
` /pseudo
` /codon_start=1
` repeat_region 49528..49551
` /note="putative"
` /rpt_unit_seq="(ttttg)x4"
` repeat_region complement(49538..49813)
` /note="putative"
` /rpt_family="AluSq"
` repeat_region 50260..50346
` /note="putative"
` /rpt_family="AluJb"
`
`GeneDX 1031, pg. 9
`
`

`

` repeat_region 50347..50642
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 50643..50694
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 50697..51000
` /note="putative"
` /rpt_family="AluSp"
` repeat_region 50986..51013
` /note="putative"
` /rpt_unit_seq="(aaat)x7"
` repeat_region 51099..51399
` /note="putative"
` /rpt_family="AluSq"
` exon 52118..52244
` /gene="BRCA1"
` /note="putative"
` /number=14
` intron 52245..54210
` /gene="BRCA1"
` /note="putative"
` /number=14
` repeat_region 52610..52624
` /note="putative"
` /rpt_unit_seq="(aat)x5"
` repeat_region 52628..52640
` /note="putative"
` /rpt_unit_seq="(tat)x4"
` repeat_region complement(52630..52886)
` /note="putative"
` /rpt_family="AluJb"
` repeat_region 53006..53171
` /note="putative"
` /rpt_family="AluSg"
` repeat_region 53167..53178
` /note="putative"
` /rpt_unit_seq="(ag)x6"
` repeat_region 53646..53665
` /note="putative"
` /rpt_unit_seq="(ttcc)x5"
` repeat_region 53667..53684
` /note="putative"
` /rpt_unit_seq="(tcctt)x3"
` repeat_region 53688..53708
` /note="putative"
` /rpt_unit_seq="(cctt)x5"
` repeat_region 53755..53768
` /note="putative"
` /rpt_unit_seq="(ctttt)x2"
` repeat_region 53769..53807
` /note="putative"
` /rpt_unit_seq="(ctttc)x7"
` repeat_region complement(53794..53959)
` /note="putative"
` /rpt_family="AluSx"
` exon 54211..54401
` /gene="BRCA1"
` /note="putative"
` /number=15
` intron 54402..57493
` /gene="BRCA1"
` /note="putative"
` /number=15
` repeat_region 54676..54965
` /note="putative"
` /rpt_family="AluSx"
` repeat_region 54965..54983
` /note="putative"
` /rpt_unit_seq="(at)x9"
` repeat_region complement(55565..55676)
` /note="putative"
` /rpt_family="AluJo"
` repeat_region 55729..55838
` /note="putative"
`
`GeneDX 1031, pg. 10
`
`

`

` /rpt_family="AluJo"
` repeat_region 55865..56164
` /note="putative"
` /rpt_family="AluSp"
` repeat_region 56175..56321
` /note="putative"
` /rpt_family="AluJb"
` repeat_region complement(56334..56626)
` /note="putative"
` /rpt_family="AluSp"
`